KEGG   Trichophyton verrucosum: TRV_03781Help
Entry
TRV_03781         CDS       T01615                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tve  Trichophyton verrucosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tve01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tve00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tve00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 697 aa AA seqDB search
MEQIKETFRRCKEEKRSALVAYVTAGYPEASETVDIILAMEDGGAVFDADIIELGVPFTD
PIADGPTIQRANTQALKNGVTVTSVLEMVRTARRKGLKAPVMMMGYYNPLLQYGEERMLK
DAKAAGVNGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSEARMKLLCGIADSFIYV
VSRMGVTGATGTLSSGLPELLKRVHTYSGNVPAALGFGVSTREHFLEVQGIAEGVVIGSQ
MVTVLGDAAPGERAQKIREYCSSITGRTVQRGPVPEVADEPGLADQLEALNTTKNPAAIP
AQFGEFGGQFVPESLMDCLAELEAGFNEAKNDPKFWEEYRSYYPYMSRPSSLHLAERLTE
HAGGANIYLKREDLNHTGSHKINNALGQVLLARRLGKKRIIAETGAGQHGVATATVCAKF
GMECVIYMGAEDVRRQALNVFRIKLLGASVIPVEAGSRTLRDAVNEALRAWVVHLDTTHY
VIGSAIGAHPFPTIVRTFQSVIGEETKAQMKELTGRLPDAVVACVGGGSNAVGMFYPFSN
DPSVKLLGVEAGGDGVDTARHSATLTGGSKGVLHGVRTYVLQNEHGQISDTHSISAGLDY
PGVGPELSNWKDSARAKFIAATDAQALIGFKTISQLEGIIPALESSHAVYGAIELAKTMK
KGENIVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaataaaggagacatttcggcgatgcaaggaggagaaaagatctgctctcgtg
gcgtacgtcacagcggggtaccccgaggccagcgagacagtcgatatcatccttgccatg
gaagatggaggtgcagtgtttgatgcagacattatcgaacttggagtcccattcacagac
ccgattgccgatggtcctaccatccagcgcgcaaacactcaggcgcttaagaatggagtc
accgtcacttctgtgctcgagatggttagaactgctaggaggaagggactcaaggcccct
gtgatgatgatgggatactataaccccttgctacagtatggtgaagagagaatgttgaag
gatgccaaagccgcaggagtcaacggttttatcatggttgacttgccgccagaagaagcc
gttcgattcagagatttatgcaaaaaagaagggctctcttatgtcccgctgattgcgccg
gctacttccgaggcccgtatgaaacttctctgcggaattgccgactccttcatctatgtc
gtctctagaatgggcgttacaggtgccaccggaacattgagctctggattacccgaactt
ttgaagcgagtgcacacatattccggaaacgtccctgctgcgctgggattcggcgttagc
accagggagcacttcctagaagtccagggtatcgctgagggtgttgttatcggtagtcag
atggtgactgtcctaggcgacgctgctccaggagagcgtgcccagaagatccgcgaatac
tgttcgagcatcacaggtcgaactgtccagcgcgggcctgtccccgaggtagccgacgag
ccaggccttgcagaccagctcgaggctcttaacaccaccaagaaccctgcagctatccct
gcacaattcggcgaatttggaggccagtttgttcctgagtcgttgatggattgcctcgct
gagctggaggctggattcaacgaggccaagaatgaccccaaattctgggaagagtaccgc
tcttactacccatacatgagccgtccaagtagtcttcatcttgccgagcgcctgactgaa
catgctggtggagctaacatctatctcaagcgagaagatcttaaccacacaggtagtcac
aaaatcaataatgccctaggccaagtccttcttgcccgtcgccttggaaagaagagaatc
attgctgaaactggtgccggtcagcatggtgtcgctaccgccactgtctgcgccaaattc
ggcatggagtgtgtcatttacatgggagcagaggatgttcgtcgccaagctctgaatgta
ttcagaataaaactccttggagcctccgttatccccgttgaggccgggtcacgtaccctc
cgtgatgcggtcaacgaagctttgcgcgcttgggtcgtccatctcgacacaacgcactat
gtcatcggctcagccatcggcgctcatcctttcccaaccatcgtccgaactttccagtca
gttatcggagaagaaaccaaagcccagatgaaagaactcactggccgcctgccagatgct
gtcgttgcttgtgttggcggtggaagcaacgcagtgggcatgttctaccccttttccaat
gatcccagcgtcaaactccttggcgtagaagccggcggtgacggagtcgacaccgcgcgt
cactcagctacccttacagggggctcgaagggcgtgctccacggcgtccgaacatatgtc
cttcaaaacgaacacggccagatctcagacacccactccatttctgccggattggattac
cccggtgttggaccggagttaagtaactggaaggattccgccagggccaagttcatcgct
gccactgacgcacaggctctaattggattcaagaccatttcgcagctggagggtatcatt
ccagcccttgagtcttcgcatgctgtttacggcgcaattgagctggctaagacaatgaag
aagggtgagaacatcgtgctcaatttgagtggacgaggcgacaaggacgtgcagagtgtt
gctgatgctcttcctgaacttggacccaaaattggctgggatttgagattctaa

DBGET integrated database retrieval system