KEGG   Trichophyton verrucosum: TRV_03781Help
Entry
TRV_03781         CDS       T01615                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tve  Trichophyton verrucosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TRV_03781
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRV_03781
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TRV_03781
Enzymes [BR:tve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TRV_03781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 697 aa AA seqDB search
MEQIKETFRRCKEEKRSALVAYVTAGYPEASETVDIILAMEDGGAVFDADIIELGVPFTD
PIADGPTIQRANTQALKNGVTVTSVLEMVRTARRKGLKAPVMMMGYYNPLLQYGEERMLK
DAKAAGVNGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSEARMKLLCGIADSFIYV
VSRMGVTGATGTLSSGLPELLKRVHTYSGNVPAALGFGVSTREHFLEVQGIAEGVVIGSQ
MVTVLGDAAPGERAQKIREYCSSITGRTVQRGPVPEVADEPGLADQLEALNTTKNPAAIP
AQFGEFGGQFVPESLMDCLAELEAGFNEAKNDPKFWEEYRSYYPYMSRPSSLHLAERLTE
HAGGANIYLKREDLNHTGSHKINNALGQVLLARRLGKKRIIAETGAGQHGVATATVCAKF
GMECVIYMGAEDVRRQALNVFRIKLLGASVIPVEAGSRTLRDAVNEALRAWVVHLDTTHY
VIGSAIGAHPFPTIVRTFQSVIGEETKAQMKELTGRLPDAVVACVGGGSNAVGMFYPFSN
DPSVKLLGVEAGGDGVDTARHSATLTGGSKGVLHGVRTYVLQNEHGQISDTHSISAGLDY
PGVGPELSNWKDSARAKFIAATDAQALIGFKTISQLEGIIPALESSHAVYGAIELAKTMK
KGENIVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaataaaggagacatttcggcgatgcaaggaggagaaaagatctgctctcgtg
gcgtacgtcacagcggggtaccccgaggccagcgagacagtcgatatcatccttgccatg
gaagatggaggtgcagtgtttgatgcagacattatcgaacttggagtcccattcacagac
ccgattgccgatggtcctaccatccagcgcgcaaacactcaggcgcttaagaatggagtc
accgtcacttctgtgctcgagatggttagaactgctaggaggaagggactcaaggcccct
gtgatgatgatgggatactataaccccttgctacagtatggtgaagagagaatgttgaag
gatgccaaagccgcaggagtcaacggttttatcatggttgacttgccgccagaagaagcc
gttcgattcagagatttatgcaaaaaagaagggctctcttatgtcccgctgattgcgccg
gctacttccgaggcccgtatgaaacttctctgcggaattgccgactccttcatctatgtc
gtctctagaatgggcgttacaggtgccaccggaacattgagctctggattacccgaactt
ttgaagcgagtgcacacatattccggaaacgtccctgctgcgctgggattcggcgttagc
accagggagcacttcctagaagtccagggtatcgctgagggtgttgttatcggtagtcag
atggtgactgtcctaggcgacgctgctccaggagagcgtgcccagaagatccgcgaatac
tgttcgagcatcacaggtcgaactgtccagcgcgggcctgtccccgaggtagccgacgag
ccaggccttgcagaccagctcgaggctcttaacaccaccaagaaccctgcagctatccct
gcacaattcggcgaatttggaggccagtttgttcctgagtcgttgatggattgcctcgct
gagctggaggctggattcaacgaggccaagaatgaccccaaattctgggaagagtaccgc
tcttactacccatacatgagccgtccaagtagtcttcatcttgccgagcgcctgactgaa
catgctggtggagctaacatctatctcaagcgagaagatcttaaccacacaggtagtcac
aaaatcaataatgccctaggccaagtccttcttgcccgtcgccttggaaagaagagaatc
attgctgaaactggtgccggtcagcatggtgtcgctaccgccactgtctgcgccaaattc
ggcatggagtgtgtcatttacatgggagcagaggatgttcgtcgccaagctctgaatgta
ttcagaataaaactccttggagcctccgttatccccgttgaggccgggtcacgtaccctc
cgtgatgcggtcaacgaagctttgcgcgcttgggtcgtccatctcgacacaacgcactat
gtcatcggctcagccatcggcgctcatcctttcccaaccatcgtccgaactttccagtca
gttatcggagaagaaaccaaagcccagatgaaagaactcactggccgcctgccagatgct
gtcgttgcttgtgttggcggtggaagcaacgcagtgggcatgttctaccccttttccaat
gatcccagcgtcaaactccttggcgtagaagccggcggtgacggagtcgacaccgcgcgt
cactcagctacccttacagggggctcgaagggcgtgctccacggcgtccgaacatatgtc
cttcaaaacgaacacggccagatctcagacacccactccatttctgccggattggattac
cccggtgttggaccggagttaagtaactggaaggattccgccagggccaagttcatcgct
gccactgacgcacaggctctaattggattcaagaccatttcgcagctggagggtatcatt
ccagcccttgagtcttcgcatgctgtttacggcgcaattgagctggctaagacaatgaag
aagggtgagaacatcgtgctcaatttgagtggacgaggcgacaaggacgtgcagagtgtt
gctgatgctcttcctgaacttggacccaaaattggctgggatttgagattctaa

DBGET integrated database retrieval system