KEGG   Trichophyton verrucosum: TRV_03791Help
Entry
TRV_03791         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tve  Trichophyton verrucosum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_03791
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TRV_03791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 321 aa AA seqDB search
MFARFSRTAGPLRQGIRKYSTEAPKSSSQAPLFAGLAVAAGAGYYYWQMQQMPGAAIKKD
RKPTFTGGDQGWVDLKLSAVEEVSHNVKKLRFELPDSESVSGLHIASALLTKFKGEGDAK
ATIRPYTPVSDEDEPGHLDLLVKKYPGGPMSTHIHDLNVGEPLSFKGPIPKYEWEANKHS
HVCMVAGGTGITPMYQLIRKIFSNPADKTQVTLIYGNVGEEDILLRRELEHLENMHPRQF
KVLYLLDKPGEGWTGGKGYVTKELVKMAFPEPKTEGIKLFVCGPPGLYKAVSGNKVSPKD
QGELTGILKELGYTKEQVYKF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcgattcagccgaacggccggcccgttgagacagggtatcagaaagtactcg
acagaggcgcccaagtcctcgtcgcaggctccgctgtttgccggccttgcagtggctgct
ggtgcaggatactactactggcagatgcagcagatgcccggcgcggcgattaagaaggac
cgcaagccaacgtttaccggtggtgatcagggatgggtcgacctgaagctttcggcggtt
gaggaggtcagccataacgttaagaagcttcggttcgaactgcctgacagcgagagcgtc
tctggtcttcacattgcctcggccctgttgaccaagttcaagggcgaaggagacgctaag
gcgaccatccggccttacacgcccgtgagcgacgaggacgagcccggccacctggacctg
ctggtgaagaagtaccccgggggcccgatgtcgacgcacatccacgatctgaacgtgggc
gagccgctctcgttcaaggggccgatccccaagtacgagtgggaggccaacaagcacagc
cacgtctgcatggtggccggcggcacgggcatcacgcccatgtaccagctcatccgcaag
atcttcagcaaccccgcggacaagacgcaggtgacgctgatttacggcaatgtgggcgag
gaggacatcctgctgcgccgggagctggagcacctggagaacatgcacccgcggcagttc
aaggtgctctacctgctggacaagccgggcgagggctggacgggcggcaagggctacgtg
acgaaggagctggtgaagatggccttcccggagcccaagacggaagggatcaagctgttt
gtgtgcgggccgccgggcctgtacaaggcggtcagcggcaacaaggtgagccccaaggac
cagggcgagctgactggtatcctgaaggagctgggctacaccaaggagcaggtgtataaa
ttttaa

DBGET integrated database retrieval system