KEGG   Trichophyton verrucosum: TRV_03941Help
Entry
TRV_03941         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tve  Trichophyton verrucosum
Brite
Protein phosphatases and associated proteins [BR:tve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TRV_03941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Motif
Other DBs
NCBI-GeneID: 9578838
NCBI-ProteinID: XP_003021954
UniProt: D4D9Z7
AA seq 137 aa AA seqDB search
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDNQLQQIVDKTIMEADQDGDGKISFEEFTRMVENTDISMSMTLGMSIIPLPL
LSHLTRRSVMLMLLSTN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcaattttcgacgaagatggcggtggtgacgtagacttccaagaattcgtttcc
gggttatcggccttcagttcgaaaggtaacaaagaggagaagcttcgatttgcctttaaa
gtatatgatatcgaccgtgatgggtacatatcaaacggggagctgtttattgttttgaaa
atgatggttggcagcaacttgaaggacaaccagctacagcagatagtggataagaccatt
atggaagccgatcaggatggcgatgggaaaataagctttgaagagtttactaggatggtt
gagaacactgacatcagcatgagtatgactttgggtatgtctataattccccttcctctc
ctttctcacctcactcggagaagcgttatgctaatgctattatcaactaactaa

DBGET integrated database retrieval system