KEGG   Trichophyton verrucosum: TRV_04158Help
Entry
TRV_04158         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tve  Trichophyton verrucosum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tve00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 178 aa AA seqDB search
MSHGKFMLVSQVMIKSYPDTFAFTVSHTTRGPRPGEVEGVAYYFTKDDAFSALVSQDGFV
EYATFNGHRYGTSKQTISGLAEKGLIAVLDIDIQGVKQLKAASSIDARYVFIVPPSLECL
EARLRRRGTEAEEDIQHRLAQSTIELSYADIPGFFDKVIVNDELDKAYDELVQFVHGS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacggcaagtttatgttggttagccaagttatgatcaagtcttaccctgataca
tttgcctttacagtatctcatactacacggggaccacgacctggggaagttgagggtgta
gcctattactttacaaaggatgatgcattttctgcactcgtctcacaagatgggttcgtt
gaatatgccaccttcaacggtcaccgttatggtacgagtaagcaaaccatctcgggcttg
gctgagaagggactcattgccgtgcttgatattgacatacagggtgtcaagcaattaaag
gcagcctctagtattgatgcccggtatgtatttattgtaccgcccagcctggaatgcctt
gaagcccggcttaggagacggggtactgaggcagaagaggatatccagcaccgacttgcc
caatctactatcgaactcagctatgctgatattccgggcttttttgacaaagtcatagtc
aacgacgagttggacaaggcttacgatgagcttgtccagtttgtccatggaagttag

DBGET integrated database retrieval system