KEGG   Trichophyton verrucosum: TRV_04210Help
Entry
TRV_04210         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TRV_04210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MASAARTFSRALARGATPVTSVRPSATRNAARFSLPAQTYRASWRRGYSTASEPQKSSSG
MYWALGAVALAAGGTYYYMNNESFAAAQKPFVPTKEDYQKVYDEIAHLLVEKDDYDDGSY
GPVLVRLAWHASGTYCKDTKTGGSNGATMRFDPESNHGANAGLKTARDFLEPVKAKFPWI
SYSDLWTLAGACAIQELQGPTIPWRPGRKDNDASACTPDGRLPDASKDQKHIRDIFGRMG
FDDREMVALCGAHALGRAHADRSGYDGPWDFSPTVMTNEFFKLLLSEKWVNKKWSGPAQL
TDNKTKTLMMLPTDMALIKDREFKKHVERYAKDSDVFFKEFSEAFVKLLELGVPFESKPE
DRFVFKPSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctgcccgtaccttctcgagagctcttgctcgcggcgctacgcctgtgacc
tccgtcagaccctcggcaactcgtaatgctgctcgattctcccttccagcacagacctac
agagcctcctggcgaagaggatactccacggcctccgagcctcaaaagtcctcctctggc
atgtactgggctctcggagctgttgccctggctgccggtggtacttattactacatgaac
aatgagagctttgctgctgctcagaagccatttgtcccaaccaaggaggactaccagaag
gtctacgacgagattgcgcaccttcttgtggagaaggatgactatgatgatggcagctac
ggaccggttctcgttcgtctcgcctggcacgcatccggcacatactgcaaggacaccaag
accggaggaagcaacggagctaccatgagattcgaccccgagtctaaccacggagccaat
gctggtctcaagactgctcgcgactttttggagcccgttaaggccaaattcccatggatc
tcctactctgatctctggactcttgccggtgcctgtgccatccaggagttgcagggtccc
accatcccatggagacctggccgtaaggataacgatgcctctgcctgcactccagatggc
cgtctccccgacgcctccaaggaccagaagcatatcagagacatctttggccgcatgggc
tttgacgaccgtgaaatggttgccctctgcggtgctcatgccctgggtcgtgcccatgct
gaccgttccggatatgacggtccttgggacttcagccctactgtcatgaccaacgagttc
ttcaagctcctcctctctgagaagtgggttaacaagaagtggtccggccctgcccagctc
actgacaacaagaccaagactcttatgatgcttcccaccgatatggccctgatcaaggac
cgtgagttcaagaagcacgtcgagcgctacgccaaggactcggatgttttcttcaaggaa
ttctccgaggctttcgtcaagctccttgagcttggtgttccattcgagtctaagccagag
gaccgcttcgttttcaagccctccgagtaa

DBGET integrated database retrieval system