KEGG   Trichophyton verrucosum: TRV_04465Help
Entry
TRV_04465         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tve  Trichophyton verrucosum
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TRV_04465
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    TRV_04465
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     TRV_04465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 305 aa AA seqDB search
MASRLTAARYGKENVRVYKVHRDEAAGTQTVVEMTVRCLLEGDIDVSYTKADNSVVVATD
SIKNTIYILAKQNPVTPPELFASIVGDHFTQKYSHIRVAHVNVVAQRWSRMNIKGKPHPH
SFLKDASEVRSTDVTVTKGKGIDIRTSLSGLSVLKSTNSQFHGFVRDEFTTLPETWDRIL
STDVDSAWTWSTFSNLEQVHGSAAKFDSTWEVSRGIILDIFSSDNSASVQNTMYKMGEQI
LAAQPLLETAELSLPNKHYFQLDLGWHKGLKNTGKDAEVYLPGSGASGLIKCTVGREGVK
EKSKL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaggttaaccgcagctcgctatggcaaggagaatgttcgtgtgtacaaggta
catcgggacgaggctgcagggactcagacggtggtcgagatgaccgtccgctgcctgctc
gagggtgatatcgatgtctcgtacaccaaggcagacaacagcgtcgtggtagcgacggac
tcgataaagaataccatctatatcctggcaaagcagaatccagtgacgccgccggagctc
tttgcttcaatcgtgggagaccatttcacgcagaagtacagccatatccgtgtagcgcat
gtcaatgtagtggcacagcggtggtcccggatgaatatcaagggcaaaccacatccgcat
tccttcctcaaggatgcctcggaggtccggtctacagacgtcaccgttaccaagggcaag
gggatcgatatcaggacgtctttgtctggcctctctgtcttgaagagcaccaactcgcag
tttcatggcttcgtgagagacgagttcactactctacctgaaacctgggaccgaatcctt
agcacagacgtcgattcggcatggacatggtcaacattctcaaacctggagcaagtgcat
ggttcggctgccaagtttgattctacctgggaagtctcgcgcggcatcatactggatatc
ttcagcagtgacaacagtgcgagcgtccagaataccatgtataagatgggagagcagata
ctcgccgcccagccgctcctggagacagccgagctcagcctgcccaataagcattatttc
cagcttgatctgggctggcataagggcttgaagaacactggcaaagacgctgaagtttac
ctgcctggctctggcgccagtggcctcatcaaatgcacagttggacgagaaggtgtcaaa
gagaagtcaaagctgtaa

DBGET integrated database retrieval system