KEGG   Trichophyton verrucosum: TRV_04494Help
Entry
TRV_04494         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1342 aa AA seqDB search
MHIFVLFIAQRHTTIRTPRTNLKRRSRMWFVFCCQDKIYVYQILILIKIGNHTPPESSEF
LPAINFDDFHNSISSREPSLSHFPMPGQLVAGIGSAPSPPKSTTRWSTTTTSASGPKPAR
QNTLNRRQSNAQKPDLEGVVSSTAGPRQPRKSIGPGASATSQVNGDDGPPQRRQSFAKRN
ATGEIRVNTNVNRGSHQPTEQPSGPSFLNTTRSQKAKSLQPVSRGNRENQITPGGSDHSR
SSSNTAIQTPGKGTVTLNTTPSSKRSSMMPHHPTGLGARTISPTDARRMKRMSLVPNPPP
IPQRSPTQLELNSPRPRSSAPSPSMIPRKSVTPSSARTTPDPHRKSYSSGVSLSSNTTYN
SARNSSGSLQGRLSQTISTSRLPTPKPRTEHSNQEEEEVPPVPAIPKAYESPKNEAHLPQ
TFTPRQTSMPFELEARRQAPKDTPSATEVEAPSTPAHQTSLGDTMMQHDNRAFSSEFKPR
ATVTHGKRSLQPLKLPPLNLMPLSAPVASKINALRDKEPKDPTPNQSTTPPPPPRQTVAK
TPSTPMTASKTSFSHAPQEHTPMPAHTSRSNSSQFILPYQTGYRSQNSSSALDFMGLSSN
RTISPYISSSLPRGTDEMNSMRDKVVSKPSTNKLTGPRPQTQFSTISASESFNFKYEPDT
IEPNPSPTVVPPSPQRKISLDQTRHTGCNDTGTADNVKFENMPPPKLPASASVNNLSRTS
PASNTNFAPAKRKQSISNVVASISSRRNKSITGEPGPTVVTQSSTEIVDEAQPNKSSSSS
SLLNPVQRLLGGPRPPPAPASAKPRVEEGELDRDDLIAEEEMRKLGSKRKDFESAARELD
ELRRRAGPKERASPAQALKIASLNIFERGEIIDYKDIYFCGTHKAKKHVGDLNAQTANFG
YDDERGDYNIVIGDHIAYRYEVVDVLGKGSFGQVVRCVDHKTGTLVAVKIIRNKKRFHQQ
ALVEVNILQKLKEWDPQNRHSVVNFTQSFYFRGHLCISTELLGINLYEFIKAHDFRGFSL
KIIRRFTKQMLMSLVLLQNHKVVHCDMKPENVLLVHPLRGDIKVIDFGSSCFENEKVYTY
IQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGYPLFPGENEQEQLACIMEIFGPPE
KHLIEKSTRKKLFFDSSGKPRLTVSSKGRRRKPSSTDLRQALKCDNPAFLDFIARCLRWD
PARRMTPRDAMQHEFITGIRAPPRSTRSLHHSHSQSPVKRFASTSATLNGRPLPNPPSTA
SSSDGTRLRDSSTNSPVKHGLPKRHSTFHHTSTTTTANPGATPKRASNIPPSGGSALPRV
TPRNASGKPDLAAAAATTSLVS
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgcatattttcgttcttttcatagcacaacgacacactaccattcgaactcccagaaca
aatctgaaacgccgttcccgaatgtggttcgtcttctgctgccaagacaaaatatatgtt
taccaaatactaattttgataaagattggcaaccatacgcctccagagagcagtgaattc
cttccagcaataaatttcgatgatttccataacagtatctcctcaagagaaccgagtctt
agtcacttccctatgccaggtcaacttgtagctggcattggatctgctccatctcccccc
aaatcaacaacgcgttggtcgactacaaccacttccgcctctggccctaaacctgctcgg
caaaataccctcaacagaagacaaagcaatgctcagaagcccgaccttgaaggtgttgtc
tcctccactgcaggccctaggcaaccccggaaatctattggacctggtgcttcggctacg
tctcaagtaaacggtgatgatggtcctcctcaaaggcgtcagagctttgcaaagagaaat
gcaacaggggaaatacgggtgaataccaatgtaaatcgtggtagtcatcaacctacggaa
caacccagtggcccttcttttctaaacacaactaggagccagaaagcaaaatccctgcag
cctgttagccgtggaaacagagagaaccaaatcacccctggcggctccgatcattctcgg
tcttcgtcaaatactgccatccagactccggggaaaggaactgtgacattaaacacgact
ccgtcgtcgaaacggtcttcaatgatgccacaccacccaactggcctaggcgcaagaacg
atttctcccacagacgctcgaaggatgaagcgaatgtctcttgttcctaatccgcctcca
atcccacagcgctcgcctacccaactagagttaaactctcctcgcccacgttcttcagca
ccatctccttctatgatacctcggaaaagcgtaacaccctcatcggcacgcactacacca
gaccctcaccgaaaatcttatagctcaggagtatccctctcgtcaaatacaacttataac
tctgctaggaattccagtggctctctacagggtcggctttcacagactatatcaacttcc
agacttccaactcctaaaccacggacagagcattcaaatcaggaagaagaggaagttcca
cctgttcctgcaatcccaaaagcgtacgaatcacccaaaaacgaagctcacctaccccaa
acttttaccccaaggcagaccagcatgcccttcgaactcgaagcgaggagacaagcacca
aaagacacaccttctgctacggaagttgaagcaccatctacacctgctcatcaaacttcc
ctaggggacaccatgatgcaacatgacaaccgtgcctttagttctgaatttaagccacga
gccactgtcactcatgggaagagaagccttcaaccactgaaactaccgccactcaattta
atgcctttgagcgctcctgttgcgagtaaaattaatgccctacgagataaggagccaaag
gaccctactcctaaccagtctactacacctcctcctcctccccgccaaactgtggcaaag
accccaagtactcctatgacggcctctaaaactagcttttctcatgccccccaggaacat
acgccaatgcccgcccacacatctagaagcaacagttcgcagtttattctaccttatcaa
accggctaccgttctcaaaacagctcaagcgctctggattttatgggattatcttctaac
cgaactatttcgccatatatatcttcatcattgcctcggggtactgatgaaatgaactct
atgcgtgataaagtggtttccaagccttctaccaacaaattgactggcccacgcccacaa
acccagttctctacaatttctgcctctgagtccttcaacttcaaatatgaaccagatact
atagaacctaatcctagccctaccgttgtaccgccctcaccgcaaagaaagataagcctc
gaccaaactagacacactggatgcaatgatacaggaacggcagacaatgtcaaatttgag
aatatgccccctcccaaacttcccgcctcagcttccgttaataatctatcacgaaccagt
cctgcatcaaatacgaattttgcgccggccaagcgaaaacaatctatctcaaatgtggtt
gccagcatttcttcacgaaggaacaagagtataacaggtgagccagggccgacagttgta
acccagtcatccacggaaatagttgatgaggcgcaaccgaacaaaagttcttcatcatcc
tcacttttgaaccctgtacaacggctacttggaggcccgcgcccaccccccgccccagca
tctgcaaagcctcgagttgaggaaggagaacttgaccgtgatgacctcatagctgaagag
gaaatgcgaaagcttggaagcaagcgaaaagattttgagtcggcagcaagggaattggat
gagcttcggcgaagagctggtcctaaggaacgggcttctccagctcaagccctaaagatt
gcaagtcttaatatctttgaacgaggagaaattattgactataaggatatctacttctgc
ggtactcacaaagccaagaagcatgtcggcgatcttaatgctcagaccgccaattttggc
tatgatgatgaacgtggagactataacatagttatcggcgatcatattgcttatcgatat
gaggttgtcgatgtccttgggaaaggcagcttcggtcaagtcgtacgttgcgttgatcac
aagactggcacccttgttgccgtcaagattattcgtaacaaaaaacgtttccatcaacag
gcactagttgaggtgaatattcttcaaaagctgaaagaatgggatccacaaaaccgccac
agtgttgtcaacttcacccaaagtttttacttccgtggacacctctgcatatctacggag
ctactgggtatcaatctttatgagtttatcaaggctcatgatttccgaggattctccctc
aaaattattcgtcgtttcactaaacagatgttaatgtctctggtgctccttcaaaatcac
aaagttgtgcattgtgacatgaaacccgaaaacgtacttctcgtacatccgctccgtgga
gatatcaaggtcattgactttggatcaagttgctttgagaatgaaaaggtgtatacatat
atccagagtcgtttctaccgctccccagaagttattcttggcatgtcgtacggaatgcca
atcgacatgtggtctcttggctgcattctcgcggagctatatactgggtatccactgttt
cccggcgagaacgagcaggagcagttggcctgtatcatggaaatattcggaccccccgag
aagcaccttatcgagaagagtactaggaagaaactgttcttcgactcctctggaaaacct
cgtttgactgtctcgtccaaggggcgccggcgcaaacctagctcaactgatcttcgacag
gctcttaaatgtgataatcctgcgttcctagatttcattgctcgctgcttgagatgggac
cctgctcgcagaatgacaccgcgtgatgctatgcaacatgaattcattactggcattaga
gctccccctcgctccacccgctctctgcaccattcgcattctcagtcacccgtcaaacga
tttgcatctacaagtgctacattaaatggtcggccccttccaaatcctccttccacagct
tcaagcagcgacggaacacgtcttcgggactcctcaaccaattctccagtcaagcatggc
ttacccaagcgccactctaccttccaccacacatccacaacgacgacggccaatccgggg
gcgacccctaagcgggcgtccaacatccctccgtcaggtggttccgctttgcctcgtgtg
acgccgaggaatgctagtgggaagccagaccttgcagccgcggcagcaacaaccagcttg
gtaagctga

DBGET integrated database retrieval system