KEGG   Trichophyton verrucosum: TRV_04621Help
Entry
TRV_04621         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tve  Trichophyton verrucosum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TRV_04621
Enzymes [BR:tve01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     TRV_04621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 922 aa AA seqDB search
MSFKPFRPPLPRKPQPSTTTATARVPSIPEEPLRKRRRVNTCGDGDKEVVETCDNETYYS
VLWRKPTAKKNKTWDGDGIIIIRGDYGYLQDISGREMGKIMLRSSLEPGTSLSISGKDVE
VESVLSQKEFLSTSNGTQKDSIEKRNNIANTPSHHSRLPSNTVSKPGMKISLNDLKTQKP
LNVSAPRSYATNSSFKNPLKQSTVLPPGSSGQITPRHDPTLPGAVVMKRPSSVPAGKQIV
DVVVDPILGKHLREHQREGVKFLYECVMGLRHFNGEGAILADEMGLGKTLQTIALIWTLL
KQNPIYGSQPVIKKALIACPVTLINNWKKEFKKWLGSDRIGVFVADGKGNLLSDFTMGRS
YSVMIIGYERLRSVQDQLTKGPGIDLVVADEGHRLKTVQNKSAQAIQSLNTTRRIILSGT
PIQNELSEFFAMVDFVNPALLGTFKSFMRDFEGPIVGARQPNAPKKVIEKGKARSEELAE
LTSPFILRRTADILSKHLPPKTEYILFCNPTSAQRSVYHHVLASPMFQSVLRNSESALQL
ITILKKVCNSPSLLKPKVEDNGKGEDTSMSALLSSLPPNIHRSLAAGSSGKIRVLDQLLY
NLQSKTKEKVVLVSNYTSTLNLLANLLTSLDLPFLRLDGSTPATKRQALVEDFNRSPSSS
CFAFLLSAKAGGTGLNLIGASRLVLFDVDWNPATDIQAMARIHRDGQKRHCHIYRLLLKG
GIEEKIWQRQVTKLGLADSVMGQKGGIAHFSQEELKDLFRLDEISKCQTHELLGCKCGGL
GEISKEIKEEDNLSAESTSVSSSEDEDHELEDSDDEFPDLPKLMKASELKISEAPQPLSK
RQKAYERAKKRFLMQYSHIDTTLLSTGGEQDVDGDEAVCDTNTSIEASIGDEVLLSLLKE
EKSGVGYLFKKNGFANAPLLVD
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaagccattccgtcccccacttcccagaaagccacaaccctcgaccacaact
gccacagcgcgcgtgccttcaatccccgaagagcctttgcgtaaacgaaggcgggtgaac
acctgtggtgatggggacaaggaggtagtagaaacttgcgataatgagacatactacagc
gtgctttggcgcaaacctacagctaagaagaataaaacttgggatggagacgggatcatc
attattaggggcgactatggatacctacaagatatatctgggcgggaaatgggcaagatt
atgctgagatctagcctggaacctggaacctcattgtctataagtggcaaggatgtcgag
gtggagtcggtgcttagccagaaggaattcctttctacttcaaacggaacacagaaagac
agcattgaaaaaaggaacaacattgcaaatactccatcccatcactctcgccttccttct
aatacagtctcgaaacccggaatgaaaatttcgctgaatgatttgaagacacaaaaaccc
cttaatgtgtctgcaccgcggagttatgccaccaatagctcttttaagaaccctttgaag
cagtctaccgtgttaccgccaggatcgagcgggcagataacccctagacatgaccctact
ctacctggcgctgtggtaatgaaaaggcctagctcagtccccgctggcaaacagatagta
gatgtcgtcgttgacccgattctaggaaaacatctcagggagcaccagagggagggtgtt
aagttcctttatgagtgtgttatggggctgcggcatttcaatggcgaaggagctattcta
gccgacgaaatgggcctggggaaaacgctgcaaacaatagccttaatttggaccctactg
aagcagaatcccatttatggttctcagccagtaatcaagaaggctctaattgcctgcccg
gttacccttattaacaactggaaaaaagaatttaagaaatggctaggcagtgatagaatt
ggggtatttgttgctgatggtaagggaaatctgttatcggattttacaatgggacgaagc
tatagtgttatgatcattggttatgagaggctacgctctgtgcaagaccagcttacaaaa
ggacctggaatagaccttgttgttgctgacgagggacatcgattgaaaactgtgcaaaac
aagagtgctcaggccattcaatctctaaacactacacgccgaattattctttctgggaca
ccaatccagaacgaattgagcgagttctttgctatggtggattttgtcaaccctgccctc
ctaggaacgtttaagtcatttatgagggattttgaaggcccaattgttggagctagacag
ccaaatgctcctaagaaggtcatcgaaaaggggaaggctagaagtgaagaactggcggag
ttgacgtctccgtttatcctccgccggacagctgatatcctttcaaaacatttgccgcca
aaaacagagtacatattattctgcaatcctacttctgcgcagagaagtgtataccatcac
gttctcgcctctcctatgttccaatctgtgttgagaaactctgaaagtgctttacaactt
atcactattctgaagaaagtatgcaacagcccctcgttgcttaagccgaaggtagaggat
aatggcaaaggtgaagacacatcaatgagtgctttattatcctctctcccgccgaatatc
catcgctctcttgccgcgggttctagcgggaagatcagagttctcgatcaattactctat
aacctacagagtaagacgaaagagaaagtcgtcctggtgtccaattatacttctacgttg
aacctgctagcaaatctcctgacttcgctagacctcccattcttgcgtctagatggttct
acacctgccacgaaacgtcaggctctggtagaggatttcaaccgctctccgtcttcatct
tgttttgcattcttactttccgcaaaagcagggggtacagggctgaacctcatcggagcc
agcaggcttgtacttttcgacgtggactggaacccagcaactgacatccaggcaatggca
aggattcatcgagatggccagaagcgacactgccatatctaccgtctgttactcaaaggt
ggaatagaagagaagatctggcagagacaagtgacaaagcttggtttggcagatagtgtt
atgggccaaaagggtggcatagcccatttttcacaggaggaattgaaagatttattccgt
ctggatgagatctccaagtgccaaactcacgaattattaggatgcaagtgtggtggtctg
ggagaaatatctaaggaaatcaaggaggaagacaacctttctgcagaatcaacctccgtt
tcttcttccgaggatgaggaccacgagctggaggattcagatgacgagttccctgatctt
cccaagctgatgaaagcgtcggaactcaagatatctgaagcacctcaacctttatctaaa
cggcagaaagcatacgagagagccaaaaagcgtttcttaatgcaatactcccatattgat
actaccttgttgagcaccggaggagaacaagatgttgacggagacgaggccgtttgtgat
acaaacacaagtattgaagcaagtatcggcgacgaagttctattgtcgttgctaaaagaa
gagaaaagtggggtgggatatctttttaagaagaatggctttgcgaatgctccattgctc
gttgattag

DBGET integrated database retrieval system