KEGG   Trichophyton verrucosum: TRV_04875Help
Entry
TRV_04875         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MATKTMTMPKHKLPKNIKLPPENERYMRACSDIANALIQDYEAQRDNSKSKKDINLNKLR
GTIAKKHYLSNLPPLTAIIAAVPEHYKKYILPKLIAKPINSDFEYSTQSYTGYEPTSMRA
IRARYDPFEQARGRVDQIKSLGHSVDKVEYIIMGGTFMSLPEEYRETFISQLHNALSGYQ
TDNVDEAVQAGEMSNIKCVGITIETRPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARD
TNRGHTVAAVAETFKLSKDAGFKVVSHMMPDLPNVGMERDLFQFQEYFENPDFRTDGLKI
YPTLVIRGTGLYELWRTGRYKNYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSG
VENGNLRELALSRMKDFGTTCRDVRTREVGINEVKNKIRPNQIELVRRDYTANGGWETFL
AYEDPKQDILIGLLRLRRCSSKYTFRPELTGQPTSLVRELHVYGSAVPVHGRDPRKFQHR
GFGTLLMEEAERIAREEHGSRKISVISGVGVRSYYAKLGYHLDGVYMSKMLDPLDDTEDS
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagacgatgaccatgccgaagcacaagcttccaaagaatatcaagctcccg
ccggagaacgagcgatacatgagagcctgctccgatatagcaaatgcgctgatccaggac
tacgaagcgcagcgagataatagcaagtcgaagaaggatatcaatttgaacaagctgcgg
ggcactatcgcaaaaaagcattatctgagcaatctgccgcctttaacagctattattgct
gctgttccggaacattataagaagtatatacttccaaaactgattgccaaaccgataaat
tcggattttgaatattctacccaatcttatactggctacgagccaacgtccatgagagct
atccgggcccgttatgatcctttcgagcaggcgcgaggtcgagtcgaccagataaaatca
ctggggcacagtgtggataaagtggaatacatcattatgggtggcacgttcatgtcactc
cctgaggagtacagagagacatttatatcacagctccataacgcacttagcggttaccag
acggataatgtggacgaggctgtgcaggcaggagaaatgagcaatatcaagtgtgttgga
atcacgatcgagacacgaccggactactgtcttgacacccatcttagcagcatgctccgg
tatggctgcacccgtttggaaattggagtacagagtctctacgaagacgtggcgcgagac
acaaatagagggcacactgtagctgctgtggcggaaacgtttaaactatcaaaggatgct
ggattcaaagtggtcagccatatgatgcctgatctcccaaatgtcgggatggagagagac
ttgttccagttccaggagtacttcgagaaccctgatttccggactgacggtcttaaaata
tacccaacccttgttatccgaggaaccggcctttatgaactttggaggaccggtcggtac
aagaactatacccccaatgctttaatcgatattgtggccagaattctcgccctcgttcct
ccatggacccgtatctaccgtgtacaaagagatatcccaatgccactcgtcacatctggc
gtagagaacggcaatctacgtgaactcgcgctcagccgaatgaaagattttggcaccacc
tgccgtgacgtgcgtacccgggaagtcggcatcaatgaagtaaagaataaaatccgacca
aatcagattgaactcgttcgacgtgattatacagcaaacggaggatgggagacattcctt
gcctacgaggacccaaaacaagatatccttatcggccttcttcggctacgaaggtgtagt
tccaagtacaccttccgacctgagcttacaggccaaccaaccagtttggtacgagagtta
cacgtttatggttccgcagtcccagtccatggccgtgacccccgcaagttccagcatcgc
ggatttggaaccttgttaatggaagaagctgagcgtattgctcgagaggagcatggaagt
cgcaaaatcagcgtcatttctggcgtgggtgtacgaagctactatgccaaactaggatac
caccttgatggagtatatatgagcaagatgctcgatcctctcgatgataccgaggattcc
gactag

DBGET integrated database retrieval system