KEGG   Trichophyton verrucosum: TRV_04958Help
Entry
TRV_04958         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tve  Trichophyton verrucosum
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRV_04958
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     TRV_04958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 520 aa AA seqDB search
MTLGRFFSDSRDAGREEDAEMQAPRDEASVLPVGVNALLTLTTDSLIIQGKAIPGCHSYF
FFFLSLICHIHCHILYIFLKYISVARVTRSIPFFNILWAEISDNHININYANPRNKLDVG
LATVCYSIERTQLSRAETWAASLLDLAYGEAQKKKRIKVLVNPFGGKGNASKIYYKEVEP
IFEAANCVIETQITEYSGHAIEIAEKIDVDAWDVIAAASGDGSIFEIFNGLGKKENAGEA
LAKLAVAHIPCGSGNAMSRNLNGTAGPSMAALCIIKGLRTPLDLVSISHGQRRTISFLSQ
AFGIVADSDLGTDNLRWMGPARFTIGFLIRLFGNTVYPCDVALKVEIDDKKRIKEHYNAV
VQNKSNAEPREEIPESGGLPPLRYGLATDPIPDDWMRISHDKLGNFYSGNMAFMSQDANF
FPASLPNDGFLDVIMIRGDISRLTAVQMLGALEDGELFDLPDVHALKISAFRITPRNPED
GYISIDGEQIPYEPFQAEVHKGLGTVISRSGFKYETGKGS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgactctcggccgctttttttcagactcaagagatgccgggagagaagaagacgcagag
atgcaggctcctcgggacgaagcatcggtcctaccggtcggggtgaatgcgttgttgacc
ttgacgacggactcgctcattatccaaggtaaggctatccccggctgccactcctatttt
tttttttttctctctcttatttgccatatacattgccatatactctatatattcctgaaa
tatatcagcgttgcgcgggtgacacgatctatcccattcttcaatatcctctgggcagaa
atatcggacaaccatatcaatattaattacgccaacccacggaataagctagatgtcggc
ctggccacggtttgttacagcatcgaacgcacgcagctatcaagagcggaaacatgggct
gcctcgctcttggatttggcatacggagaagcacagaagaagaaacggataaaggtgctg
gtgaatccctttggcgggaaaggaaacgcgtccaagatctactacaaggaagtcgagccg
atattcgaagctgccaactgtgttatcgagacccagatcaccgagtactctggccatgcc
attgaaattgccgagaagatcgatgtagacgcatgggacgtcattgcggctgcttccgga
gacgggtcgattttcgagatattcaacggtctaggcaaaaaggagaacgccggagaggcc
cttgcgaagctggccgttgcacacattccctgcggctctggcaatgccatgagcaggaac
ctcaacggcacggcagggccgagcatggctgctctttgcatcataaagggcctacgcact
ccccttgaccttgtatcgatcagccacgggcagcgtcgaaccatctctttcctctcccaa
gcattcggcatcgtagcagactctgacctcggcacagacaacctgaggtggatgggccct
gctcgtttcacaatcggcttcttgataaggttgttcggcaacacggtatatccatgcgac
gtggcactcaaggttgaaattgacgacaagaaacgcatcaaagagcactataatgccgtt
gtgcagaacaaatcaaacgcagagccacgcgaagagatcccagagtcaggaggcctgcca
cccttaagatatggtcttgcaacagaccccatcccagacgattggatgagaatctcccat
gataagctcggcaacttctattcagggaacatggcgttcatgtctcaggacgcaaacttc
ttccctgcctcgcttccaaacgatggtttcttagacgtcatcatgatcagaggagatatc
agccgattaactgccgtccagatgctgggtgccttggaagatggggagctcttcgacttg
cctgatgtgcacgcgctaaaaatatcagctttcaggatcactcccaggaacccggaagat
ggctatatcagcattgacggcgagcagatcccgtacgaaccattccaggctgaggttcat
aaaggtctcggcacagtcatctcccggtcaggcttcaagtatgaaactggcaagggatct
taa

DBGET integrated database retrieval system