KEGG   Trichophyton verrucosum: TRV_05045Help
Entry
TRV_05045         CDS       T01615                                 

Definition
zinc-binding oxidoreductase, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
tve  Trichophyton verrucosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRV_05045
Enzymes [BR:tve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TRV_05045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 610 aa AA seqDB search
MRVTRLLWSSLVIPAAVGFQVRFKPSEDTALDTVDDGTLQSLLDNIGLNGSNAWDTRPGL
VIASPSKKDSNYFFTWTRDSALVLKCITDAFAAGNTALQETIHEYISSQARIQLLNTRSG
GLSSGGLGEPKYHVDETPYNEDWGRPQADGPALRATALIAYARWLLENDYYDVAKSIVWP
VVKNDLSYVSEHWNTTAFDLWEEVNSPSFFTTIVQHRALVEGINMARALDETCPHCESQA
PQALCYLQSYWTGSAVRSNYGQGRSGLDVASILGSIHTFDPEGECDDTTFQPCSARALAN
HKAVTDSFRSIYKINGGIKQGQAVAVGRYPEDVYFNGNPWYLATYAAAEQLYDAMYQWNK
IGKITVTDVSMPFFKDIYPEVQTGTHESSSPEFGNIIAAVKAYAEGYIEVAKKYTPCTGM
LSEQFSRDNGTPLSVADLTWSYASYLTVMARRNSVVPASWGEKNARDIPSTCVPSSATGP
YQTATITYWPPNLTPTAQPSPCPTALPTKNNVRFRLLATTQVGEDVFLVGSIPELGSWDV
KKAVPLNADIYADNCHQWYVDIELPTAVAFEYKFIRKRGGEVVWEQDPNRKYTVPQTCGV
SGAIKRDTWR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaacccgtctgctatggtcttccctggttataccggctgctgtgggctttcag
gttcggtttaagccgtctgaggatactgctctcgacaccgtggacgatggcacactgcag
agcctgctcgataacatcgggttgaacggctcgaatgcctgggatacgaggccggggttg
gttatagctagtcctagcaaaaaggattcaaactacttctttacctggacgagagactcg
gctctagtgcttaagtgcattaccgacgcctttgcagctggaaataccgctctacaggag
acaatccacgaatacatctcatctcaagctcgcatccaattgctcaacacccgctctggt
ggtttgtcaagcggagggctcggagaaccgaaatatcatgtggacgaaaccccgtataat
gaggactggggccgacctcaggctgatgggcctgcgctaagagctactgccttgattgca
tacgcaagatggcttcttgaaaatgactactatgatgtagctaaatcgattgtttggccg
gttgtcaaaaatgacctttcatatgttagcgaacactggaacactactgcctttgatcta
tgggaggaagtaaatagtccatcctttttcaccactatcgtccaacaccgggctttggtg
gaaggtataaacatggcgcgtgcattggatgaaacctgccctcattgcgaatctcaggca
ccccaagcactctgctacttgcagtcgtactggactggatccgccgtccggtcgaactat
ggtcaaggtcgctccgggcttgatgtagcctctattctgggctctatccacacatttgac
cccgaaggagaatgtgacgacactaccttccaaccttgctctgcgcgagcattagcaaac
cacaaggcggtcacagattccttccggtccatctataagattaacggtggtatcaagcag
ggccaggccgtggccgtcggcaggtatcccgaagacgtatactttaatggaaacccatgg
tatctagctacttatgctgctgcagaacagctatacgatgccatgtatcagtggaacaag
ataggaaaaatcacggtgacagatgtttccatgccgttcttcaaggatatataccccgaa
gtgcagacagggacacacgagtcttccagcccggagttcggcaatataatagccgcagta
aaggcttatgcagaggggtatattgaagttgcaaaaaaatacaccccgtgcacaggaatg
ctttcagagcagttttccagagataatggaacaccactatctgtggcggatctcacttgg
tcatatgcatcgtatctaaccgtaatggcccgacgcaattccgtcgttccggcttcgtgg
ggagagaagaatgcccgagatatcccatctacttgtgtgccatcatcggcaaccgggcca
tatcaaacggctactataacctactggccaccaaacctcacccccaccgctcagccgtcg
ccctgccctacggccttgccaacaaagaacaatgtccgcttcagattgctcgctacgaca
caggtgggcgaagacgtcttcctggttggatctatcccagagctaggctcgtgggacgtc
aagaaggctgttccgctcaatgccgacatatatgcagacaactgtcaccaatggtatgtt
gacattgagcttccgactgccgtggctttcgagtacaagttcatccgcaagagaggagga
gaggtggtgtgggagcaggatccgaatcggaagtacactgtacctcagacctgcggcgtc
tcgggggcgattaagagagacacctggcgatag

DBGET integrated database retrieval system