KEGG   Trichophyton verrucosum: TRV_05063Help
Entry
TRV_05063         CDS       T01615                                 

Definition
histone acetyltransferase, putative
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRV_05063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1090 aa AA seqDB search
MAATPLAAYDNNYPEQEPEIDSEQDAEGDEDPEFYDATAQAGIVTTYENSTVTVDGTYHG
KGDTDEGGAVDENNVNHEKEPSLIDDGNDSKEKVDQDAAVIGSASEDGKSASEADELDAE
FEELSNESNAVASEASSESDSEAEEEWEAESNEQEDADTEPPVENNCIVCKEDEEHDPSE
VFEEPLICDTCSVHYAGKWKCPLCKHLHSQPDTRNSSTARQKSTVSSVTKDLLPADNDTQ
DPNSHSVFNSLIIEDDPLDGSRSLRKRKSSSYEAENRRSTTRKRRKVTPPHGQALPTTRA
SGSRSRAPSQNQLAENDVTTVHENRAPRQRRTRNAQKYYCSVVQKQEGRLILSFNLDQEK
IQKILNSKPRPRSQRRRPLPKPPTIPEPPLVSHFAPTNPTPYAAPFYSFHDRENDELKSK
PYGGILSEAEADTSRTVPLSTDRDKFEAARQKAEEEWRKKMMANEEDSDNALLSSQKLSG
PPSKIKYINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDFVAWRHKLKCPAKH
PPGDEIYREGSVSIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEYDEW
GCHFVGYFSKEKRPSSSNNVSCILTLPIHQRKGYGNLLIDFSYLLTRLEGRTGSPEKPLS
DMGLVSYRNYWRLVLCYKFRDKKSPTSITAISEQTGMTPDDVISALEGLSALVRDPVTKT
YALRLDYDFFERYIESWEKKGYVKLNPNSLVWTPYIMGRSNKSHYDHAPIHTVAPREEID
ADEPTAATNSIPSNGYGLGISASDADTANSVAGSGADTVNTNGKGFSEASPSLFDAPGPP
STSALSFADVMAKQAPSTNGRQSSSTPSNPAFGIPPTRFEIFPPPQGASTSTPTVKRRPG
RPFGTRKKVRSTAQSPARTSGHNTPKKSKPLRLGTPSTATRPLRFSVRRARSSMLGDNPD
TKHDTDPESPGGTKRFDYPNPFASTSNGPADQPEANGSPGSDKNDEETHINKIPESMEID
RQLLNGIEDHTRNHQPQLVDGTNKNDTELTNGLTKPMDDTSQTIATQVGNPGENGASDAP
SEKKIPLQCS
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaccccactggccgcttacgataacaactatcccgaacaagaaccagaaata
gatagcgaacaagacgctgaaggggacgaggaccctgagttttatgatgcgactgcgcag
gctgggatagtcacgacgtatgaaaactcgactgtgacggttgatgggacataccatgga
aaaggggacactgatgaaggaggtgctgtggacgaaaataatgtcaaccacgaaaaggaa
cccagcctcatagatgatggaaatgattctaaagagaaggtggatcaggatgctgcagtt
ataggaagtgctagcgaggatggcaaatcggcaagtgaagcagatgaactggatgctgaa
ttcgaagagctttcaaacgagagtaatgcagttgccagtgaagcgtcctctgaatctgac
tccgaagctgaagaggaatgggaagctgaaagcaacgaacaagaggatgctgatacagaa
ccccctgttgagaacaattgcattgtttgtaaagaggatgaagagcatgatccaagtgaa
gtctttgaagagccattaatatgcgacacatgtagtgttcattatgccggtaaatggaag
tgtccgttatgtaaacatttgcactcccaaccggacacaaggaactcctccaccgctcga
caaaaatctactgtctctagtgttacaaaagatctgctccctgcggacaatgatacccaa
gatccaaattctcattccgtatttaactcattaatcatcgaagatgatccactggatggc
tcccgctctttgcgaaaaaggaaatcatcatcctatgaggctgaaaatagacgctcgacc
acacggaaacgacggaaagtcactcctccgcacggacaagcgttaccgacaacgagggcc
agcgggagtcgctcgcgtgccccgagccagaaccaacttgcagaaaatgatgttacaact
gtgcacgaaaaccgagcacctcgccagaggagaacgagaaacgcacaaaagtattactgc
agcgttgtgcagaaacaagaagggcggttaatactgtcattcaatcttgaccaggaaaag
attcaaaagatactgaacagtaaaccaaggccgaggagccaacggcgaagaccattacct
aaacccccaactatacctgagcctcccctggtatcacactttgcaccgacaaacccaact
ccatatgctgcacctttctactccttccacgaccgagaaaatgatgaactcaagtcaaag
ccttatggtggaattttatctgaggccgaagccgatacgtcgcgaactgtacctctgtcg
acagatagggataagtttgaggcagctcgtcaaaaggcagaagaagaatggcggaagaaa
atgatggcaaatgaggaagactcggataatgctctcctctcttctcaaaagctgtctggg
ccaccaagcaaaatcaagtatatcaactttggcggttatgagattgagacttggtatgct
gcaccatatcctgaagaatacagtcgcaatcgggttttatacatttgcgaattttgcctc
aagtatatgaactccgatttcgttgcatggagacataaactcaaatgccctgcaaagcat
cctccgggcgatgagatttatcgggaagggtctgtttctatatttgaagttgacgggcgg
aagaatcccgtctattgccaaaatctctgtttactggccaagctcttcctgggttcaaag
acactctattatgacgtggagcctttcttattctacgtcatgacagaatatgatgaatgg
ggctgtcattttgttggatatttcagcaaagagaagcgaccgagttcctcgaataatgtc
tcctgtatcctgaccctcccaatccaccagagaaagggttatggaaatctcctgattgat
ttttcttatcttctcacccgactagaaggaagaacaggctctccggaaaaaccattatct
gatatgggcctggtttcctatcgcaattactggcgtcttgttctatgttataagtttcgg
gataaaaaatcaccgacaagcattacagcgatatctgaacagaccggtatgactcccgat
gatgttatatccgcgttagaaggcctgagtgctctcgtccgtgatcctgtcactaagact
tatgcgctccgcttggactacgatttttttgaaaggtacatagagtcttgggagaaaaag
ggctacgtcaagttgaatcctaattctctggtatggacgccgtatataatgggccgtagt
aacaagtcccactatgaccatgcgcccattcatactgtcgctcctcgcgaagagattgat
gccgatgagccaactgctgcaactaattccatacccagcaacggatatggcctcggcatt
agcgcaagtgacgcggatacagcaaacagcgttgcaggaagtggtgctgatactgtcaat
accaatggaaagggcttctctgaagcttcgccttcattgttcgacgctccaggaccgcct
tccaccagcgctctgtcattcgccgatgttatggcgaaacaagctcctagcactaatggt
cgtcaatcgtcatctactccttcaaaccctgcatttggcattcccccaacgaggttcgag
atcttccctccgcctcaaggtgccagtaccagtactcctaccgttaagcgacgaccaggc
cggccatttggaactcggaaaaaggttcgctccactgcacaatctccagcaaggacgagc
ggacataatacgcccaaaaagagcaaacccctacgcctgggtactccttccacggcaaca
aggcccctgcgcttcagcgttcgacgggcgagaagtagcatgctaggtgacaacccggac
acaaaacacgacactgatcctgaaagtcccggcggaaccaagcgatttgactatcctaac
ccatttgcatcgacgtccaatggtcccgccgatcaacccgaagccaatggctcccctgga
tctgataaaaatgacgaggagactcatatcaataaaataccagagtcgatggaaattgac
cggcaattgcttaatggtattgaagaccacacacgcaatcaccaaccgcagctagttgat
ggtacgaataagaacgatactgagcttacgaatggtttaacgaagccgatggatgatacc
tctcaaactatcgccacacaggtgggcaaccctggcgaaaatggagcttccgatgctcct
tcggagaaaaagattccactacaatgttcatga

DBGET integrated database retrieval system