KEGG   Trichophyton verrucosum: TRV_05075Help
Entry
TRV_05075         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tve  Trichophyton verrucosum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRV_05075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRV_05075
   00620 Pyruvate metabolism
    TRV_05075
   00640 Propanoate metabolism
    TRV_05075
  Energy metabolism
   00680 Methane metabolism
    TRV_05075
Enzymes [BR:tve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TRV_05075
Lipid biosynthesis proteins [BR:tve01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TRV_05075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 677 aa AA seqDB search
MAEVDAAKAPVVVEAHQVETVGVPAEYHQHSTKTHLKSFEEYKTLYEESISSPDTFWARL
ARELVTFDKDFNTTHIGSLKGGDNAWFVGGRLNASYNCVDRHALKNPDKVSIIYEADEPG
EGRSITYGELLKQVSSFAWTLKQQGVKKGDTVAIYLPMIPEALVAFLACSRIGAVHSVVF
AGFSSDSLRDRINDANSKVVITSDEGKRGGKLIGTKKIVDEALKQCPGVTSCIVFKRTGA
EVPWTQGRDLWWHEEVEKYPSYIAPESMDSEDPLFLLYTSGSTGKPKGLMHTTAGYLVGA
AATGKYVFDIHEEDRFFCGGDVGWITGHTYVVYAPLLLGATTVVFESTPAYPNFSRYWDV
IEKNKVTQFYVAPTALRLLKRAGDQHIHHDMKDLRVLGSVGEPIAAEIWKWYYEVVGKKK
AQVVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIVDPVTGEELKGNDVEGVL
AFKQPWPSMARTVWGAHKRYMDTYFNVYPGFYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEAALITHCKAAISVEDGASVAEAAVVGVHDELTGQAVNAFVALKTGNEIGEE
IRKELVMQVRKSIGPFAAPKAVYVVEDLPKTRSGKIMRRILRKILSGEADSLGDISTLSD
PTVVPKIIEMYEATKKK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtagacgctgctaaggccccggtggtcgtggaagcccaccaggtcgagacc
gttggtgtgcctgcggagtaccaccagcactccaccaaaacgcacctgaagagctttgag
gaatacaagactctttatgaggagtctatctcgagtccggataccttctgggcgcggctg
gcgcgggaattagtgacctttgataaagacttcaacacgacgcacatcggctccttaaag
ggaggtgataatgcttggtttgttggtggaaggctgaatgcttcttacaactgtgtcgac
cgtcatgcgctcaagaatccggacaaggtttctatcatctacgaggccgatgaacctggc
gaagggcgcagcatcacttacggcgagctgcttaagcaagtctcgagctttgcctggact
ttgaagcagcagggggtaaagaagggagatacggtggccatctatttgcctatgattcca
gaggctctggttgctttccttgcttgttctcgcattggtgctgtgcactctgtcgtcttt
gcaggcttctcgtccgactcgctgcgtgaccgtatcaatgacgccaactccaaggttgtc
attacctctgacgagggcaagcgaggcggaaaactcatcggaaccaagaagattgtcgac
gaggctttgaagcagtgtcctggagtgactagctgcatcgtgttcaagaggactggagca
gaggttccatggactcaaggacgcgatctctggtggcacgaggaggttgagaagtatcct
agctatattgctcctgagtccatggattcggaagaccctcttttcctcttgtacacttca
ggctcaaccggcaagcccaagggattgatgcacaccactgctggttatctggttggcgcc
gccgcaactggtaaatacgtctttgacattcatgaggaagaccgattcttctgcggtgga
gacgttggttggattaccggacatacctatgttgtctacgctccactgcttctcggtgcg
accacagttgttttcgagagtactcctgcctatccgaacttctcgagatactgggatgtc
attgaaaagaataaggtcacgcagttctacgttgcaccaaccgcactcagacttctcaag
cgtgctggtgaccagcatatccaccatgatatgaaggacctccgagtattgggaagtgtt
ggtgagccaattgcagctgagatctggaaatggtactatgaagttgttggcaagaaaaag
gcccaagttgtcgacacatactggcaaaccgagactggctctcacgtcattactcccctt
ggtggaatcactcctaccaaaccgggaagcgcctctctgccattcttcggcattgagcct
gccatcgtcgacccagttaccggcgaagaactgaagggtaacgatgtagagggtgtattg
gcattcaagcaaccgtggccaagcatggctcgcacagtttggggtgcccacaagcgatac
atggacacttatttcaatgtctacccaggattctatttcactggagacggcgccggccga
gaccatgacggatactactggatcagaggaagagttgacgacgtcgtgaacgtctccggc
catcgactttctaccgctgaaatagaagctgctctcatcacacactgtaaggctgccatt
tctgtggaggatggagcttccgttgccgaggctgccgtcgttggtgtacacgatgagctc
accggccaggcagtcaacgccttcgttgccctcaagacaggcaacgaaatcggcgaggag
atccgcaaggagttagtaatgcaggttcgaaaatctatcggaccctttgcagctcctaag
gcggtctatgtcgttgaagacctgcccaagactcgcagtggaaagatcatgcgacgtatt
ctcaggaagatcttgagcggcgaagctgacagcttaggcgatatctcgactctttcggat
ccaacggtggttcccaagattatcgagatgtatgaggcaacaaagaagaaatga

DBGET integrated database retrieval system