KEGG   Trichophyton verrucosum: TRV_05342Help
Entry
TRV_05342         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tve  Trichophyton verrucosum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TRV_05342
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    TRV_05342
   04113 Meiosis - yeast
    TRV_05342
Protein phosphatases and associated proteins [BR:tve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TRV_05342
Ubiquitin system [BR:tve04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     TRV_05342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 824 aa AA seqDB search
LTSSPLTSQLYRPRKKKKQLPSMAPSGPHIASQLRQLIYYHLDNNLLRNALFLAGRLHAF
EPRSSEAAYLLSHCLLQSGQPKYAWEVCRNAGSRGTHLGCAYVYAQACLDLGNYMEGITA
LERSKPQWTSKNNWNKHSENRRQHLPDAAAVLCLQGKLWHAHKDIHKAVDCYVEALKLNP
FLWDAFLGLSETGANVRVPNIYKMTPEMVAMLTPSASESSFSEKSIANSQPLQAQPSANH
NVDPFSSTNGTSYGSSALWEKLNGSSVSVASAVLPEGLETPITQSDSDDFRVRTGPNTGD
TYGEPPFAPARKSRTMQVLGVESCVDPPRLKSNSTRSRSKPKSASAEEPVPSKETTSSQQ
NASAMERKRTVSGHIAPTNTAQQPVEPGAPQRRSVRLFNQIRPTSKFSTSAASLGTREGR
EIKKAKSTSSKSRSTATAAPLGRSTTSSRKHGGESTETDSKESRSNGTSSESLNGPSRPQ
VPDKSKEIDALAWTLDLFSRLASGHAALCSYRCQDALQIYNSLPQNQRETPWVLSQIGRA
YYEQALYSDAEKYFSRVRTIAPSQLEGMEVYSTVLWHLKNEVELAYLAHELMDTDRLAPE
SWCAIGNSFSLQSDHDQALKCFRRATQVDPAFAYGYTLQGHEYMSNEEYDKAQDAYRAAI
KANPRHYSAWYGLGKVYERMGKLRFAEQHLRTASNINPANVVLICSIGLVLERQNNLKAA
LLQYSRASSLSPHSVLARLRKARTLLKLNEVNLAHIELKVLKDVAPDEPNVHYLLGKLYK
MIQDKGNAIKHFTTALNLDPKAAQFIKEAMESLENPDDVDDDMT
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
ctaaccagctcccctcttacttctcaactctaccgccctcgaaaaaaaaaaaaacaacta
cccagcatggctccctcggggccgcatatcgccagccagctacggcagctgatatactac
catctcgataataatctgcttcgaaacgccctgttcctggccggccggctgcatgcgttc
gagcccaggtcgtcggaggccgcctacctgctctcgcactgtctgctgcagtctggacag
ccaaagtacgcctgggaggtctgtcgtaatgccggatcgcgaggcacgcatcttgggtgt
gcctatgtctatgctcaggcatgtcttgacctcggaaactacatggagggaatcactgcc
ttggagcgaagcaagcctcagtggacatcgaagaataactggaataaacatagtgaaaac
agacgacaacatcttcctgacgcagctgcggttctttgtctccagggcaagctatggcat
gcacacaaggacatacataaagctgtcgactgctatgtcgaagctctcaaactgaaccct
ttcctgtgggatgctttccttgggctttctgaaacaggtgcgaatgtgagagtgccgaat
atctacaagatgacaccagagatggtggcaatgctcactccatcagcctcggagagctcg
ttctctgagaaatctatcgccaatagccagccactacaagcacagcccagtgctaatcac
aatgttgatcccttttcgtcgacgaacgggactagctacggcagctcagctctatgggag
aaactgaatggcagcagtgtcagtgtggcatctgccgtcctccctgaagggctagaaact
ccaatcacacaaagtgattcagatgatttccgtgtccggaccggccctaatacaggagac
acatacggggagccaccctttgctcccgctcgaaagtcacggacaatgcaagttctaggc
gttgaaagctgtgtagatccgccacggctaaaatcgaacagcactcgatccaggtcgaaa
cccaagtcagcgtcagccgaggaaccagttcccagcaaggaaactacatcttctcagcag
aatgcttcggcaatggagcgcaaaagaacggtatcaggacatatagctcctacgaacaca
gcacagcagcctgttgaacccggtgccccccagcgacgaagcgttcgtttgttcaatcaa
atacgaccgacaagcaagttctctacatctgcagccagtctgggaactcgtgaaggacga
gagataaaaaaagcaaagtctaccagttcgaagagccgcagcaccgccacagctgctcct
ctgggacgatcaacaacctcgtctcgaaaacacggaggcgaatcaacagaaaccgacagc
aaggaaagccggtcgaatggaacctcgtcagagtcccttaacgggccgtcgagacctcaa
gtgccggataagtccaaggagatcgatgctcttgcatggacactggatctcttttcaagg
ctggcgagcgggcacgcagcactgtgtagctacaggtgccaggatgctctccagatatac
aattctttaccgcagaatcaacgggaaacaccgtgggtattgtcacagattggtcgggcg
tattacgaacaggccttatacagtgatgctgaaaaatacttctccagggtgcgaacaata
gcaccatcacagttggaaggaatggaggtgtactcgacggtgctctggcacctgaagaac
gaagtcgaactggcataccttgctcatgagttgatggataccgatcgcctggcacccgaa
tcgtggtgcgcaattggaaactccttctctctgcagtcagatcatgaccaggcgttgaaa
tgcttcagacgagcaacacaggtagatcctgcgttcgcttacggctacactctccaggga
cacgaatacatgtcgaacgaggaatacgacaaggcccaggatgcataccgcgccgccatc
aaagccaaccccagacactacagcgcctggtacggtctcggcaaggtctacgagcgaatg
ggcaaactcaggttcgccgaacaacatctccgcaccgcttcgaacataaatcccgccaat
gttgttttgatatgcagcattggcctcgtcctcgagcgacagaataacctcaaggccgca
ctgttgcagtacagtcgagcctcgtcactatcaccccactccgtgctagctcgattacgc
aaagcacgaacgttactgaagctcaatgaggtgaatctcgctcacatagagctaaaggtg
ctcaaggatgtggctcccgacgagccaaatgtgcattatctgttgggcaagttatataaa
atgatacaggataagggcaacgcaataaaacactttaccaccgccctgaacttggatcca
aaggccgctcaattcatcaaggaagccatggagtcccttgaaaaccctgatgacgttgat
gacgacatgacatga

DBGET integrated database retrieval system