KEGG   Trichophyton verrucosum: TRV_05526Help
Entry
TRV_05526         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tve  Trichophyton verrucosum
Brite
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRV_05526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGKAPAEKKEAGKKKRTKARKETYSSYIFKVLKQVHPDTGISK
RAMSTLNSFVNDIFERVATEASKLAAYNKKSTISTREIQTSVRLILPGELAKHAVSEGTK
AVTKYSSSAR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaagctgctgagaagaagccctcgaccggcggcaaggccccggctggcaaa
gctcccgctgagaagaaggaggccggcaagaagaagcgcaccaaggccagaaaggagacc
tactcctcctacatcttcaaggtgctcaagcaagtccaccctgacactggtatctccaag
cgcgccatgtccaccctcaactccttcgtcaatgacatcttcgagcgcgttgctaccgaa
gcctccaagctcgctgcctacaacaagaaatccaccatctccaccagagagattcagacc
tccgtccgtctcatcctgcccggtgaactggccaagcacgctgtctctgagggcaccaag
gccgtcaccaagtactcttcctctgcccgataa

DBGET integrated database retrieval system