KEGG   Trichophyton verrucosum: TRV_05529Help
Entry
TRV_05529         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tve  Trichophyton verrucosum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRV_05529
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRV_05529
  Amino acid metabolism
   00310 Lysine degradation
    TRV_05529
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TRV_05529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MAESISEGTLKQFSKEIGDYVEQDEEIATIETDKIDVTVNATESGTIKEFLAAEEDTVTV
GQDLVRLELGAAPEGAKEKPAAAAPAAEESKPAEPKQETAAPAPKEESKEQPKEQPKKEA
APAPAPKQEKKAPAPEEAAKSTPGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEV
DMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNASIEGPNGGDTIVYR
DYVDISVAVATEKGLVTPVVRNVETMGLVEIEQSIADLGKKARDNKLTIEDMAGGTFTIS
NGGVFGSLMGTPIINLPQTGVLGLHAIKDKPVVVNGKIEIRPMMYLALTYDHRLLDGREA
VTFLVKVKEYIEDPRRMLLC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccatctcagagggtaccctcaagcagttctccaaggagatcggtgactat
gtcgaacaggacgaggagattgctaccattgaaaccgacaagatcgacgtgaccgtcaat
gccaccgagtccggcaccatcaaggaattcctcgccgcagaggaagacaccgtcaccgtc
ggccaggacctcgtccgtctcgagctcggtgctgctccagagggcgccaaggagaagcct
gccgccgctgctcctgctgctgaggagagcaagcctgctgagcccaagcaggagactgcc
gcccctgctcccaaggaagagtccaaggagcagcccaaggaacagccaaagaaggaggct
gctccagccccagctccaaagcaggagaagaaggctcctgctcccgaagaagctgccaaa
tccacccctggcagcagagaagagcgcagggtaaaaatgaaccgtatgcgcctacgtatc
gccgaacgcctgaaacagtcccagaacacagctgcctccctcaccacctttaacgaagtc
gacatgtcctcacttatggaattccgcaagctctacaaggacgacgtgctcaagaagacc
ggcgtcaagctcggtttcatgtctgccttctcccgtgcctgcgtgctcgccatgaaggat
gttcccgccgtcaatgcctcgattgagggccccaacggtggtgacactatcgtctaccgc
gattacgtcgatatcagtgttgccgtggccacggagaagggccttgttactcctgttgtg
cgcaacgttgagaccatgggtctcgttgagatcgagcagtccattgctgatctcggcaag
aaggcccgcgacaacaagctcaccatcgaggatatggccggcggcaccttcaccatcagc
aacggcggcgtctttggctcgctcatgggcacccccatcatcaaccttccccagaccggt
gttctcggcctacacgccatcaaggacaagcctgtcgtagtcaacggcaagatcgagatc
agaccaatgatgtatctcgccctcacctatgaccacagactgctcgacggccgggaagca
gtcaccttcctcgtcaaggtcaaggagtacattgaggacccccgccgcatgctcctctgc
tag

DBGET integrated database retrieval system