KEGG   Trichophyton verrucosum: TRV_05529Help
Entry
TRV_05529         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tve  Trichophyton verrucosum
Pathway
tve00020  Citrate cycle (TCA cycle)
tve00310  Lysine degradation
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
Module
tve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRV_05529
  Amino acid metabolism
   00310 Lysine degradation
    TRV_05529
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TRV_05529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl SAGA-Tad1 GCV_H DUF3614 FAP Hamartin Presenilin
Motif
Other DBs
NCBI-GeneID: 9584150
NCBI-ProteinID: XP_003020411
UniProt: D4DEG2
AA seq 380 aa AA seqDB search
MAESISEGTLKQFSKEIGDYVEQDEEIATIETDKIDVTVNATESGTIKEFLAAEEDTVTV
GQDLVRLELGAAPEGAKEKPAAAAPAAEESKPAEPKQETAAPAPKEESKEQPKEQPKKEA
APAPAPKQEKKAPAPEEAAKSTPGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEV
DMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNASIEGPNGGDTIVYR
DYVDISVAVATEKGLVTPVVRNVETMGLVEIEQSIADLGKKARDNKLTIEDMAGGTFTIS
NGGVFGSLMGTPIINLPQTGVLGLHAIKDKPVVVNGKIEIRPMMYLALTYDHRLLDGREA
VTFLVKVKEYIEDPRRMLLC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccatctcagagggtaccctcaagcagttctccaaggagatcggtgactat
gtcgaacaggacgaggagattgctaccattgaaaccgacaagatcgacgtgaccgtcaat
gccaccgagtccggcaccatcaaggaattcctcgccgcagaggaagacaccgtcaccgtc
ggccaggacctcgtccgtctcgagctcggtgctgctccagagggcgccaaggagaagcct
gccgccgctgctcctgctgctgaggagagcaagcctgctgagcccaagcaggagactgcc
gcccctgctcccaaggaagagtccaaggagcagcccaaggaacagccaaagaaggaggct
gctccagccccagctccaaagcaggagaagaaggctcctgctcccgaagaagctgccaaa
tccacccctggcagcagagaagagcgcagggtaaaaatgaaccgtatgcgcctacgtatc
gccgaacgcctgaaacagtcccagaacacagctgcctccctcaccacctttaacgaagtc
gacatgtcctcacttatggaattccgcaagctctacaaggacgacgtgctcaagaagacc
ggcgtcaagctcggtttcatgtctgccttctcccgtgcctgcgtgctcgccatgaaggat
gttcccgccgtcaatgcctcgattgagggccccaacggtggtgacactatcgtctaccgc
gattacgtcgatatcagtgttgccgtggccacggagaagggccttgttactcctgttgtg
cgcaacgttgagaccatgggtctcgttgagatcgagcagtccattgctgatctcggcaag
aaggcccgcgacaacaagctcaccatcgaggatatggccggcggcaccttcaccatcagc
aacggcggcgtctttggctcgctcatgggcacccccatcatcaaccttccccagaccggt
gttctcggcctacacgccatcaaggacaagcctgtcgtagtcaacggcaagatcgagatc
agaccaatgatgtatctcgccctcacctatgaccacagactgctcgacggccgggaagca
gtcaccttcctcgtcaaggtcaaggagtacattgaggacccccgccgcatgctcctctgc
tag

DBGET integrated database retrieval system