KEGG   Trichophyton verrucosum: TRV_05611Help
Entry
TRV_05611         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tve01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tve00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MWTTCEQQHIYQADSQTADDTTHGQPAKMTSPTTTIAQKFLSRPQELGVVAVGFSDGQKM
TQPKAGVDAGPTALLEAGLLDQVRDELGYKVDFDSKVHDYADVKPAESEDPRYRNMIKPR
TVSAVTRRLSEQVYEHAREGKMVLTLGGDHSIAIGTVSGTARAIRERLGREMAVIWVDAH
ADLNRPEESESGNVHGMPVSFLTGLAKDEREDVFGWLTKDHLISTRKLVYIALRDVDRAE
KQTLREHGIKAFSMHDVDRHGIGRVVEMALAHIGNDTPIHLSFDVDALDPQWAPSTGTPV
RGGLTLREGDFIAECIHATGNLIAMDLVEVNPSLASMGASETVRAGCSLVRCALGDTLL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtggacgacctgcgagcagcaacacatatatcaagcggatagccagactgcagacgac
acgacacacggacagccagcaaagatgacttcccctaccacgaccatcgcgcagaagttc
ctctcccggccccaggagctgggcgtcgtcgccgtgggcttttccgacggccagaaaatg
acacagcccaaagccggcgtggacgcgggcccgacggcgctgctcgaggccggcctgctg
gaccaggtgcgtgacgagctcggctacaaggtcgacttcgacagcaaagtgcacgactac
gccgacgtcaagcctgcggagagcgaggacccgcgataccgcaacatgatcaagccccgg
accgtctctgcggtgacccggcggctgagcgagcaggtctacgagcacgcccgcgagggc
aagatggtgctgacgctgggcggcgaccactcgatcgccatcggcaccgtctcgggcacc
gccagggccatccgcgagcgcctcggccgtgagatggcggtgatctgggtcgacgcccac
gccgacctgaaccgcccagaggagagcgagagcggcaacgtccacggcatgccggtgtcg
ttcctgacgggactggccaaggacgagcgcgaggacgtcttcggctggctgaccaaggac
cacttgatcagcacccggaagctggtctacattgccctgcgagacgtcgaccgtgccgag
aagcagacgctgcgcgagcacggcatcaaagcctttagcatgcacgacgtcgaccgccac
ggcatcggccgcgtcgtcgagatggccctcgcccacatcggcaacgacacccctatccat
ctgtccttcgacgtcgacgccctcgacccccagtgggcgcccagcaccggcacgcccgtc
cgcggcggcctgaccctgcgcgagggcgacttcatcgccgagtgcatccacgccactggc
aacctgatcgccatggacctggtcgaggtcaaccccagcctggcctcgatgggcgccagc
gagaccgtccgcgccggctgctcgctcgtccgctgcgcgctgggcgacaccctgctctag

DBGET integrated database retrieval system