KEGG   Trichophyton verrucosum: TRV_05665Help
Entry
TRV_05665         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
Organism
tve  Trichophyton verrucosum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 453 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVWYKQHPASIVTQKQQQQQRGEQR
ATANATWKTDSAASNIQTNDGVAIKKVTNVFSKRILAKRALREIKLLQHFRGHRNITCLY
DMDIPRPENFNEVYLYEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLH
RDLKPGNLLVNADCELKICDFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYT
KAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRN
LPYMHKQPFARLFPNANPDALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCP
TPFDFHFEVVDDVQEMRRMILNEVQRFRDHVRQPSHIQAALAQQLQPQQTNVPIPEDKGA
WRHEDPRPQEAVFDGTSEHDLEASLHRGMDMIR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcttcaaggacggaaggtcttcaaggtgtttaaccaagactttatcgtcgat
gagcgctataatgtcaccaaggagctgggccagggagcctacggcatcgtctggtataaa
caacatcccgccagcatcgtcacgcagaagcagcagcagcagcagcgaggagagcaacga
gcaacagctaatgcgacctggaaaactgatagtgctgcctccaacatccagaccaacgat
ggtgtggccatcaagaaagtcacaaatgttttcagcaagcgtattctggccaagcgggcc
ctgagagagatcaagctgctacagcacttccgtggccatcgcaacatcacctgtctctat
gatatggacattccacggccggaaaacttcaacgaggtgtacctgtatgaagaactcatg
gagtgtgatcttgcggctatcattcgttcaggacagccccttacggacgcccatttccag
tccttcatctaccagattctatgtggactaaaatacatccattcggctaatgtgctgcac
cgtgacttgaagcccggtaacttattagtcaacgccgactgtgagctgaagatttgcgac
tttggccttgctcgtggattctcgattgaccctgatgagaacgctggatacatgaccgag
tatgttgcgacaagatggtaccgtgctccagagatcatgttgagcttcccaagctacacc
aaagccattgatgtgtggtccgttggatgtattcttgccgagctgcttggagggcgacct
ttcttcaaaggccgtgactacgtcgaccagctaaaccagatcctccactaccttggaacc
cccaccgaggagactctctgccgtatcggctccccacgcgcccaggagtacgtccgcaac
ctaccctacatgcacaaacagcccttcgccagactattccccaacgccaacccggacgct
ctcgatctcctcgaccgaatgctcgcctttgacccttcatcgcgtatcagcgtggaagag
gccctggagcatcgctacctgcacatctggcatgatgcaagcgatgaacccaactgccct
acccccttcgacttccactttgaggtcgtcgatgatgtgcaggagatgcgacgcatgatt
cttaacgaagtacagcgtttccgcgaccatgtgcgccaaccttctcatatccaggctgct
cttgcccagcagctacaaccccagcagaccaatgtgcctatcccagaggacaagggagct
tggagacacgaagatccacgtccacaggaagcagtgtttgatggaacgagcgaacacgat
cttgaagcatcattacatagaggcatggacatgattagataa

DBGET integrated database retrieval system