KEGG   Trichophyton verrucosum: TRV_05725Help
Entry
TRV_05725         CDS       T01615                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tve  Trichophyton verrucosum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_05725
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TRV_05725
Enzymes [BR:tve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TRV_05725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 855 aa AA seqDB search
MSEEEEIRRSLGQLFIVGFDSLTASEDIKSLIKAPFYIGNIILFRRNVHDSEQLITLTNE
LQQTARDAGHARPLFIAADQENGWVSQIKPPIATQFPGAMALGATGSIEDATQIGRATGE
MLDALGINMNYAPVCDVNSEPSNPVIGIRSPGDDGASVGRIASAFAKGLREKKIVPCAKH
FPGHGDTTIDSHYGLPIVGKSIEELEACELIPFRRVTAENVESVMTSHIVLPALEESNLP
MTLSKSCVDFLRERLQYDGLLVSDCLEMDAIREYYGTEKGAAMAIAAGVDCAMVCHTLKV
QVGAYNEVYQAFKQGDITSEGVAKSVARVAALKDKFISWKSVFRKRKPELLSELRLAHER
LSTRIYARSTTLVRDTQKVIPLKPAENVVYAYISLVGENVAVPHTLPHTQSKFWDVIKQY
HSYTIECPVLQDIILEDDEMTKAKISEADAVILVTKDAKMSVDQVELTKLIEGLSKKLIV
VAIGGPYDFLEDEDFVKTYLTIYEPTVEAFIPAVRIIFGDIDAKGKLPVSVKPCQVPIEP
FNADRDLAKVVELWHGLLPRYAVPSATLSHVLSRPNGNHLVSRVEDKVVGFVATYTNEDR
PTAFIPVVLVDSGHQGKGVGTALIEHARIYLRNGYSTSSVTIGSSFPRFWPGVPMDISKQ
AQEFFIHRGFCPERRPTARDYTVDLLSYEAPKGVLERAEKAGVTYAPWRKEQYEECMEKQ
RKLFGKDPVWMEAYEGLAQTGQYNQVMVATDSSTGEQIGWTLMQELGIGMTRELAMQQLV
GIKSGQIGCVGVVPEARNKGVGLALITHAALDLKRRGMEHVFVDWSNHVNWYERAGFKVW
GEYRTMVLHELAKTN
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggaagaagaaatcagaagaagcctgggccagctcttcatcgtcggctttgat
agcctgactgccagtgaagatatcaagtcactcatcaaagcacccttttacatcggaaat
atcattctgttccgacgtaatgtccacgattcagagcagttgattactctcacgaatgag
cttcagcaaaccgctcgggatgcgggtcatgcccggcccctgttcattgccgcagaccag
gagaacggctgggtcagccagattaagccgcccattgctactcagtttcctggagctatg
gcgctgggagcaacgggctccatcgaagacgctactcagatcggtagagctacgggtgaa
atgctagatgcacttggtattaacatgaactatgctcctgtctgcgatgtaaactcagag
ccatccaacccggttatcggaattcggtcaccaggagatgacggagcgagcgtgggacga
atagcttcggcttttgccaaaggcttgcgtgagaagaagattgttccatgtgcgaagcat
ttcccaggccatggagatacgacgatcgattcccattatggccttcccatcgtgggcaaa
tccatcgaagaactggaagcatgcgaactgatcccgttccgcagagtgactgcggagaat
gtcgagtccgtcatgacgtcccatattgttctaccggcactcgaggagtcaaatctaccc
atgactctcagcaaaagctgcgtggacttcctccgggaaagactccagtatgatggactg
ctggtgtctgactgcctggagatggatgctattcgggagtactatggcactgaaaagggc
gctgctatggcaattgccgctggcgtagattgtgccatggtgtgtcatacactgaaagtt
caagttggtgcgtataacgaagtctatcaagctttcaagcagggggatatcacctctgaa
ggtgttgccaaatcagtcgcaagagtcgcagcattgaaagacaagtttattagctggaag
tcagtcttcagaaaacggaagcccgagctgctttcagaacttcgtctggcacatgaaaga
ctttcaacgagaatttatgctcgaagtacaacattggtgagggatacacagaaagtcatt
cctctcaagccagctgagaacgtggtatatgcatacatttctctagtcggagaaaacgtt
gcggtcccccatactcttccacacacccagtcaaaattctgggacgtgatcaagcaatac
cactcatatacaattgaatgcccagttctccaggacatcatacttgaagatgacgaaatg
accaaagcaaagatatcagaagctgatgcagttattctggtaaccaaagatgcaaagatg
tccgtagaccaggtagagctgacgaagctgattgaggggttgtccaagaaactcattgta
gtggctattggaggtccgtacgacttcctagaggatgaggattttgtcaaaacctacctc
accatatatgagccaaccgttgaagcctttatacctgctgttagaataatatttggagac
atcgacgcgaaaggaaagcttccagtgtcggttaaaccttgccaggtaccgattgagcct
ttcaacgcagacagggatcttgctaaagtcgtcgaactttggcatggacttttaccaaga
tatgccgtaccatcggcgacactttcccacgttttaagcaggccgaatggaaaccacctt
gtttcacgtgttgaagataaagtagtaggatttgtggccacatatacaaatgaagaccgg
cctacggcattcatccccgtggtccttgtggactccggccaccagggcaagggggtggga
accgcactgattgagcacgcccgaatataccttcgaaacggatattccacatcatcagtt
acaatcggttcaagcttccctcggttctggccgggcgtcccaatggatatttcaaaacaa
gcccaggagttctttatccatcgtgggttctgtcctgagcgtagaccaacagcaagggac
tacactgtcgacttactctcatacgaagcaccaaagggcgtcttagagcgcgcagaaaag
gcaggagtcacatatgccccctggagaaaggaacaatacgaagaatgtatggagaaacag
cgcaagctgtttggcaaagaccccgtgtggatggaggcttatgaagggctagcacaaaca
ggccagtacaaccaggtaatggtagcaacggactcatcgacaggtgagcagatcgggtgg
acattgatgcaggaattgggcataggaatgacacgggagctcgccatgcagcagctggtg
ggtatcaagtctggtcaaatcggctgcgtaggagttgttcctgaggcaagaaacaaggga
gttggtctcgctctgatcacgcatgctgcccttgatctgaaacgacgagggatggagcat
gtattcgtcgactggtcgaaccacgtcaactggtacgagcgtgctggcttcaaggtctgg
ggcgagtatcggactatggtgttgcatgagctggcgaagactaactag

DBGET integrated database retrieval system