KEGG   Trichophyton verrucosum: TRV_05769Help
Entry
TRV_05769         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tve  Trichophyton verrucosum
Pathway
tve00860  Porphyrin and chlorophyll metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TRV_05769
Enzymes [BR:tve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TRV_05769
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRV_05769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 9583935
NCBI-ProteinID: XP_003020163
UniProt: D4DF26
AA seq 301 aa AA seqDB search
MLMYPLFITDRPDEQIPVPSLPNQYQIGLNKLIPFLKPLIKKGLRSVILFGVPLAPGAKD
ALGTMADDPSGPVIQAIRLLRSTFPSLYITADVCMCEYTSHGHCGILREDGSLNNTLSVE
RLSDIAVAYAQAGAHCVAPSDMNDGRVRAIKLKLIEAGISHQVVLMSYAAKFSGCLYGPF
RDAAGSSPSFGDRKCYQLPPSGRGLARRAIQRDINEGADIIMVKPAGAYLDIISDAKELG
RDLPVAAYQVSGEYAMIHAGAKAGVFELKAMVMESMQGILRAGGSIVTTYFVPELLDWLE
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgtaccccctcttcatcacggacagacccgacgagcaaattcctgtgccttcg
ctaccaaaccagtaccagattggcctgaacaagctgatcccattccttaaaccattgatt
aaaaagggcctaaggtccgtcatcctcttcggcgtaccattggccccaggagccaaagat
gcactggggaccatggcagatgacccttccgggcccgtgatacaagccattcgcctgcta
cgcagcactttcccatcgttgtatattactgcagacgtgtgtatgtgcgagtacacctcc
cacggccactgtggcatcctgcgcgaagacggatcattaaacaacacactctccgttgag
aggctgtctgatatcgctgtggcgtatgcacaagctggagcacactgcgttgctccctct
gacatgaatgatggacgggtcagggcgattaagctcaagctcattgaagcaggtatttcg
catcaagtagttctcatgtcctatgcggcgaaatttagcgggtgtctctacgggcccttc
agggatgctgcaggatcatcgccttcgttcggtgatagaaagtgctatcagctcccgccc
agtgggcgggggctggcgaggagagctattcagagagatattaacgaaggggctgatatt
atcatggtaaagcctgcaggagcctatttggatatcattagtgacgcgaaggagctgggg
agggatcttcctgttgccgcgtaccaagttagcggggaatatgcaatgattcatgctggt
gcgaaggccggtgtatttgagcttaaggcgatggtaatggagagtatgcaaggaatactc
agggctggtgggagtattgtgacgacgtactttgttccagagctgctggactggttagag
tcttaa

DBGET integrated database retrieval system