KEGG   Trichophyton verrucosum: TRV_05925Help
Entry
TRV_05925         CDS       T01615                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tve  Trichophyton verrucosum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TRV_05925
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TRV_05925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 371 aa AA seqDB search
MAPSIRVIGSLNVDMVSVTPRFPVPGETLTATSFTTSPGGKGANQAVACGRLSRSRTSSS
SSPSGVLANVEMVGAVGRLDAHFGTLLQPTLANSGVSTDRVRRIDDEHTGVAVIIVDTSA
AGENRILFSPNANYTGMKPTDEVISQSLSTPLPDLIVLQAEIPIDTVIGILRGVAAKKKL
QESDVEVVFNPAPAPEGGLPDDVYAAVDHLIMNETECGLMAPEELRDSGLSQEEQRNKIA
VHFHALGVRYVIVTLGAKGVWYSAAEPGKVAQQDAGTWIRSVNEVPASRVDKVVDTTAAG
DTFVGGYCVQIAQWREQRRAAGKACSALTTDEWKDRYGIVTEEAVRCGTRASAQCVQRSG
AMDSIPFRDEI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtcgattcgagttatcggttcgctgaacgtggacatggtctccgtgaccccc
cggttccccgtcccgggagagacgctgacggcaacatccttcacgaccagcccaggaggc
aaaggagccaaccaagccgttgcctgcggtcgtctttctcgatcccgaacttcttcctcc
tcttctccctcgggtgtgttggccaacgtcgagatggtcggcgcagtcggccggttagac
gcacacttcggcacattgttacaacctacactcgccaactccggagttagcacagaccga
gtacggaggatagacgatgaacacacaggtgtagctgtgattattgttgacacatctgct
gctggcgagaataggatactgttttcacctaatgcaaactacactggaatgaaacctacg
gatgaagtgatttcgcagtcactgtcaactcctctaccagacctcattgtcctgcaggca
gaaatccccattgatacggttattggtattctgagaggagtagctgctaagaagaaactt
caagaaagtgatgttgaagttgtattcaaccctgctcccgcacctgaaggcgggctaccg
gacgatgtatatgcagccgttgaccatttgatcatgaacgagacggagtgtgggttgatg
gcacccgaggagttacgagatagtggcctctctcaagaagaacagaggaacaaaattgcc
gttcacttccatgcccttggggtgcgatatgtgattgtcacactcggagccaagggggta
tggtatagtgccgccgagcctggtaaggtcgctcagcaggatgcgggcacgtggattagg
tctgtcaacgaggttcctgcctcaagggtggacaaggttgttgatactacggctgcgggt
gatacgttcgttggcggatactgtgttcagattgcacagtggagggaacagaggagggcg
gcgggaaaggcttgctcggctcttacaacagatgaatggaaggataggtatgggattgtg
acagaggaagctgttagatgtggtacaagggcctctgctcaatgcgtccagcgatctggg
gcaatggatagtatcccattcagggatgagatctag

DBGET integrated database retrieval system