KEGG   Trichophyton verrucosum: TRV_05973Help
Entry
TRV_05973         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRV_05973
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_05973
Ubiquitin system [BR:tve04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    TRV_05973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 935 aa AA seqDB search
MSMMTELTYSSYNSKKETGMVGLRNQGATCYLNSLLQSLFFTNAFRKAVYQIPTEDEANK
KNSAWTLQRLFYSLQTCETPVSTSELTESFGWKSRVIFEQQDVQELSRLLMEKLEVQMKG
TPAELALPNLFVGKAKTYISCINVDYESSRIEDFWDIQLSVKGNKTLDDSFKSYINVEIM
DGENKYDAGSSHGLQDARKGVIFESFPPVLHLHLQRYEYDFNRDAMMKINDRHEFPEEFD
ASPYLSADADRSEPWEYKLFGVLVHSGDLNAGHYYAFLRPTKDGHFYKFDDDKVIRATNK
ETLEENFGGEYANGAGMRQPYTRNYSTKRSMNAYMLVYIRKSRIDDVLVNVGNEDVPAHL
AKQVDEERSEAIRRKKEREEQHLYMNIAVVSDDSFREHHGFDLMSTDLDPGDPALPTTYR
VRRTMKVGEFTQLVAEDKGLDVERVRLWAMVNRQNKTVRPDQPLRDPEDTVETAAFKLSS
RAAPFKVYAEVREPGSDGKVVWPETQGPNASVLVILKHFDPVTQTLSGVGHVFVKKQSKV
SELAGPILQMMNWPAGTSFSLYEEIKPSMIDQLKPKQTFQASEIQDGDIICFQRTQSESE
LGPNVLYKDARQYYDYLLNRVMIKFAPVKPESDDSTFTLALSRKMSYNQFSAKVGEYLKV
DPTHLRFAPVATTTGNPKPFIRRNVAHNLSQILTTQYSAYGNSGQRNDALYYEILETSLS
EYETKKLIKITWLPEGIIKEVYCCPGLLFIVPFYFCLGACANIYYFIQQPFELLVPKQGN
VTDILQGLQQKANLDNEVMQNVRVFEAHYSKMQKELTDKFGVAGIMDTISLYAEPIPEDE
QNMKEGDFRINAFNFDKEPNREHGIPFKFVVKPGEKFIDTKERLSKRTGIRGKQFEKIKF
AVVSRAMYSNPTYLEDGTPYPLLKRTSLKKTANTI
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgatgacagagctaacatactccagctataattctaagaaagagactggcatg
gttggtctcagaaaccagggcgcaacctgctaccttaactcgctcctccaatctttgttt
ttcaccaatgcgttccgaaaggctgtataccaaattcccacagaagatgaagcaaataaa
aagaactctgcctggacccttcaacgtttattctactcactccaaacatgtgaaactcct
gtttcaacctcagaactcactgagtcctttggatggaagtcaagggtaatctttgaacag
caggatgtccaggaactctctcggttactcatggagaagctcgaggtgcaaatgaaaggc
acaccggctgaattagcactcccgaacctctttgtgggcaaagccaaaacttacatttct
tgtatcaacgttgattatgaatcgtcgcggatagaggacttctgggatatacagctgagt
gtcaaaggaaacaagaccctggatgacagcttcaaatcttacatcaacgttgagatcatg
gatggagagaacaaatatgacgcaggatcttcccatggtttgcaagacgcccgaaaaggt
gttattttcgaaagcttcccacctgtcttgcatcttcacctacaaagatacgaatacgat
ttcaaccgcgatgcaatgatgaaaatcaacgaccggcatgaattcccagaggagttcgat
gcatcgccctacttatccgcagatgcagacaggtctgaaccctgggaatataagcttttc
ggcgtacttgttcatagtggcgaccttaatgctggacactactacgcctttttgcgccca
accaaagatggccacttctacaaattcgatgatgacaaggtgatcagagcaacaaacaag
gaaacgttagaagagaactttggaggagagtatgcaaatggagccgggatgcgccaacct
tatacccggaattactcaacaaaacgctcgatgaacgcatacatgttggtttacatccgg
aagtccagaatcgacgacgtccttgtcaacgttggaaacgaggatgtgcctgcccatctt
gcgaaacaagtcgatgaagagcgctctgaggcgatccgtaggaaaaaggagcgtgaagag
caacatctctacatgaatattgcagttgtatccgatgactcgtttagggaacatcacggc
tttgacttgatgagtactgatttggatcccggtgatccagccctcccgaccacctaccga
gtccgtcgtaccatgaaggtgggcgagtttacgcaacttgtggcagaagataagggcctt
gatgtggaacgagtccgcctatgggctatggttaatcgtcaaaacaaaactgtccggcct
gaccagcctctacgggacccagaagacactgtcgaaacagctgctttcaagctttcgtca
agagccgcgcctttcaaggtatatgctgaagtgagagaacctggaagtgatggaaaggtt
gtttggcctgaaacgcaaggaccgaatgcgtctgttctggtcattttgaagcatttcgat
cctgtgacacaaactctctctggtgttggccatgttttcgttaagaagcaatccaaggtt
tcagaacttgctgggcccattctccagatgatgaattggcctgccggtacatccttttcg
ctatatgaggaaatcaaaccttccatgattgaccagctgaagcctaagcagacattccaa
gcttcggagattcaagatggagatataatatgtttccagcggacccaaagtgaatcagaa
cttggacccaacgttctctacaaggacgcaagacaatactacgactatcttctcaaccgc
gtcatgataaaatttgcgccagtgaagccagaatccgatgactcaacttttacacttgct
cttagccgcaagatgagctataatcaattttcagctaaagttggcgagtacttaaaagtt
gacccgacacaccttcggtttgcacctgttgcaactactactggcaatcccaaaccattt
attcggcggaacgttgcccacaacctttcccagatcctgactacccagtactctgcttac
ggtaactcagggcagagaaacgatgcattatattatgagattctggagactagcttaagt
gaatatgaaactaagaagctaataaaaatcacctggctgccggagggaatcatcaaagag
gtatactgctgccctggtttactttttatagttcctttttatttttgtcttggggcgtgc
gctaatatatattatttcatacagcaaccgttcgagttacttgtgcctaaacaaggaaat
gtcactgatattctacaaggccttcaacaaaaagccaatctggataatgaggttatgcaa
aatgtccgtgtttttgaagcacattacagcaaaatgcagaaagaactaacagacaagttt
ggcgttgctggaataatggacacaatctccctttatgcggagcctattccagaagatgaa
caaaacatgaaggaaggtgattttaggataaatgctttcaattttgataaggagccaaat
agagagcatggcatacctttcaaatttgttgttaaaccaggagagaaattcatcgatacc
aaagagcgcttgtccaaaagaacaggcatccgaggtaaacaatttgagaagataaaattt
gcagttgtgtctcgagccatgtactcaaatccaacatatcttgaagatggtactccatac
cccttactaaaacgcacctctcttaagaaaacagctaacactatctag

DBGET integrated database retrieval system