KEGG   Trichophyton verrucosum: TRV_05973Help
Entry
TRV_05973         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRV_05973
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_05973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 935 aa AA seqDB search
MSMMTELTYSSYNSKKETGMVGLRNQGATCYLNSLLQSLFFTNAFRKAVYQIPTEDEANK
KNSAWTLQRLFYSLQTCETPVSTSELTESFGWKSRVIFEQQDVQELSRLLMEKLEVQMKG
TPAELALPNLFVGKAKTYISCINVDYESSRIEDFWDIQLSVKGNKTLDDSFKSYINVEIM
DGENKYDAGSSHGLQDARKGVIFESFPPVLHLHLQRYEYDFNRDAMMKINDRHEFPEEFD
ASPYLSADADRSEPWEYKLFGVLVHSGDLNAGHYYAFLRPTKDGHFYKFDDDKVIRATNK
ETLEENFGGEYANGAGMRQPYTRNYSTKRSMNAYMLVYIRKSRIDDVLVNVGNEDVPAHL
AKQVDEERSEAIRRKKEREEQHLYMNIAVVSDDSFREHHGFDLMSTDLDPGDPALPTTYR
VRRTMKVGEFTQLVAEDKGLDVERVRLWAMVNRQNKTVRPDQPLRDPEDTVETAAFKLSS
RAAPFKVYAEVREPGSDGKVVWPETQGPNASVLVILKHFDPVTQTLSGVGHVFVKKQSKV
SELAGPILQMMNWPAGTSFSLYEEIKPSMIDQLKPKQTFQASEIQDGDIICFQRTQSESE
LGPNVLYKDARQYYDYLLNRVMIKFAPVKPESDDSTFTLALSRKMSYNQFSAKVGEYLKV
DPTHLRFAPVATTTGNPKPFIRRNVAHNLSQILTTQYSAYGNSGQRNDALYYEILETSLS
EYETKKLIKITWLPEGIIKEVYCCPGLLFIVPFYFCLGACANIYYFIQQPFELLVPKQGN
VTDILQGLQQKANLDNEVMQNVRVFEAHYSKMQKELTDKFGVAGIMDTISLYAEPIPEDE
QNMKEGDFRINAFNFDKEPNREHGIPFKFVVKPGEKFIDTKERLSKRTGIRGKQFEKIKF
AVVSRAMYSNPTYLEDGTPYPLLKRTSLKKTANTI
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgatgacagagctaacatactccagctataattctaagaaagagactggcatg
gttggtctcagaaaccagggcgcaacctgctaccttaactcgctcctccaatctttgttt
ttcaccaatgcgttccgaaaggctgtataccaaattcccacagaagatgaagcaaataaa
aagaactctgcctggacccttcaacgtttattctactcactccaaacatgtgaaactcct
gtttcaacctcagaactcactgagtcctttggatggaagtcaagggtaatctttgaacag
caggatgtccaggaactctctcggttactcatggagaagctcgaggtgcaaatgaaaggc
acaccggctgaattagcactcccgaacctctttgtgggcaaagccaaaacttacatttct
tgtatcaacgttgattatgaatcgtcgcggatagaggacttctgggatatacagctgagt
gtcaaaggaaacaagaccctggatgacagcttcaaatcttacatcaacgttgagatcatg
gatggagagaacaaatatgacgcaggatcttcccatggtttgcaagacgcccgaaaaggt
gttattttcgaaagcttcccacctgtcttgcatcttcacctacaaagatacgaatacgat
ttcaaccgcgatgcaatgatgaaaatcaacgaccggcatgaattcccagaggagttcgat
gcatcgccctacttatccgcagatgcagacaggtctgaaccctgggaatataagcttttc
ggcgtacttgttcatagtggcgaccttaatgctggacactactacgcctttttgcgccca
accaaagatggccacttctacaaattcgatgatgacaaggtgatcagagcaacaaacaag
gaaacgttagaagagaactttggaggagagtatgcaaatggagccgggatgcgccaacct
tatacccggaattactcaacaaaacgctcgatgaacgcatacatgttggtttacatccgg
aagtccagaatcgacgacgtccttgtcaacgttggaaacgaggatgtgcctgcccatctt
gcgaaacaagtcgatgaagagcgctctgaggcgatccgtaggaaaaaggagcgtgaagag
caacatctctacatgaatattgcagttgtatccgatgactcgtttagggaacatcacggc
tttgacttgatgagtactgatttggatcccggtgatccagccctcccgaccacctaccga
gtccgtcgtaccatgaaggtgggcgagtttacgcaacttgtggcagaagataagggcctt
gatgtggaacgagtccgcctatgggctatggttaatcgtcaaaacaaaactgtccggcct
gaccagcctctacgggacccagaagacactgtcgaaacagctgctttcaagctttcgtca
agagccgcgcctttcaaggtatatgctgaagtgagagaacctggaagtgatggaaaggtt
gtttggcctgaaacgcaaggaccgaatgcgtctgttctggtcattttgaagcatttcgat
cctgtgacacaaactctctctggtgttggccatgttttcgttaagaagcaatccaaggtt
tcagaacttgctgggcccattctccagatgatgaattggcctgccggtacatccttttcg
ctatatgaggaaatcaaaccttccatgattgaccagctgaagcctaagcagacattccaa
gcttcggagattcaagatggagatataatatgtttccagcggacccaaagtgaatcagaa
cttggacccaacgttctctacaaggacgcaagacaatactacgactatcttctcaaccgc
gtcatgataaaatttgcgccagtgaagccagaatccgatgactcaacttttacacttgct
cttagccgcaagatgagctataatcaattttcagctaaagttggcgagtacttaaaagtt
gacccgacacaccttcggtttgcacctgttgcaactactactggcaatcccaaaccattt
attcggcggaacgttgcccacaacctttcccagatcctgactacccagtactctgcttac
ggtaactcagggcagagaaacgatgcattatattatgagattctggagactagcttaagt
gaatatgaaactaagaagctaataaaaatcacctggctgccggagggaatcatcaaagag
gtatactgctgccctggtttactttttatagttcctttttatttttgtcttggggcgtgc
gctaatatatattatttcatacagcaaccgttcgagttacttgtgcctaaacaaggaaat
gtcactgatattctacaaggccttcaacaaaaagccaatctggataatgaggttatgcaa
aatgtccgtgtttttgaagcacattacagcaaaatgcagaaagaactaacagacaagttt
ggcgttgctggaataatggacacaatctccctttatgcggagcctattccagaagatgaa
caaaacatgaaggaaggtgattttaggataaatgctttcaattttgataaggagccaaat
agagagcatggcatacctttcaaatttgttgttaaaccaggagagaaattcatcgatacc
aaagagcgcttgtccaaaagaacaggcatccgaggtaaacaatttgagaagataaaattt
gcagttgtgtctcgagccatgtactcaaatccaacatatcttgaagatggtactccatac
cccttactaaaacgcacctctcttaagaaaacagctaacactatctag

DBGET integrated database retrieval system