KEGG   Trichophyton verrucosum: TRV_05995Help
Entry
TRV_05995         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tve  Trichophyton verrucosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tve00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 710 aa AA seqDB search
MKSERYTQYTSQPQTMAAKVPDGTGVVDLDPWLEPFKDALRSRYKRATDWIRKIDETEGG
LDKFSKMLSHAQGYEKFGFNVASNGDITYREWAPNATTAHLIGDFNKWDPTATPLKKNDF
GVWEGILPAKNGELAIPHNSKVKKHQITMTTPSGERLDRIPAWTKRVTQDLSVSPVYDNV
FWHPPKEEQYQFKHAAPPKPKSLRIYEAHVGISSPKTEVATYKNFTEVMLPRIKYLGYNA
IQLMAIMEHAYYASFGYQVNNFFAASSRYGIPEDLKELIDTAHSMGIVVLLDVVHSHASK
NVLDGLNMFDGTDHLYFHSGGKGNHDLWDSRLFNYGNHEVLRFLLSNLRFWMEEYRFDGF
RFDGVTSMLYIHHGIGTGFSGGYHEYFGSSVDDEGVAYLALANEMLHKLYPNCITVAEDV
SGMPALCLPLVLGGVGFDYRLAMAVPDMYIKLLKEKKDEEWDMANIAFTLTNRRHGEKAI
AYAESHDQALVGDKTLMMWLCDNEMYTNMSVLTELTPLIERGMSLHKMIRLVTHGLGGEG
YLNFEGNEFGHPEWLDFPRQGNNNSFWYARRQLNLTEDHLLRYKFLNEFDRKMQLTEEIY
GWLQSPQAYISLKNEQDKVLVFERAGLLWVFNFHPTNSFTAYRVGVEQAGTYRIVIDTDD
SDFGGFDRNAKGTRFFTTDLEWNGRKNYTELYLPTRTALVSSKFSPFDPG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagagagatacacacagtatacttcccagccgcaaaccatggcagcaaaagtt
ccagatggcacaggagtcgttgatttggatccgtggctcgagccgttcaaggacgctctg
agaagtagatacaagcgggcaaccgactggatccgcaagattgacgagacagagggcggg
ctggacaagttcagcaagatgctaagtcatgcacagggctacgagaagtttggtttcaat
gttgcgagtaacggcgacatcacctacagagagtgggctccaaacgcgaccacggcccat
ctcattggtgatttcaataaatgggatccaactgctacaccattgaagaagaatgacttc
ggagtgtgggaaggcatcctccctgcaaagaacggagagcttgccataccgcacaacagc
aaggtcaaaaagcatcagattaccatgaccacaccatcgggggagcgacttgacagaata
ccagcttggaccaaaagagtaactcaggatctcagtgtctctccagtgtatgacaacgta
ttctggcatccacccaaggaggagcagtaccagttcaaacacgctgcccctccaaagcca
aagtcgcttcgtatctacgaggcacatgtgggaatatcatcgcccaagacagaggttgca
acatataagaatttcactgaggtcatgcttcctcgtatcaaatacctaggatacaatgct
atccagcttatggccatcatggagcatgcatactatgcaagcttcggataccaggtcaac
aacttctttgcagcaagtagtcgctatggcattccagaagacctgaaggagttgatagac
acagctcacagcatgggtatcgtggttctccttgacgtggtgcacagccatgcatccaag
aacgtgctggatgggcttaacatgtttgatggaacggaccatctctatttccattcaggt
gggaagggtaaccatgacctatgggatagtcgtctcttcaactatggaaaccatgaggtg
ctcagattccttctcagtaacctgagattctggatggaagaatatcgttttgacggcttc
cgtttcgatggggtcacaagcatgctgtacattcatcatggaatcggaactggattttcc
ggtggatatcatgagtactttggttcgtctgttgacgatgaaggtgttgcatatctggct
ctggcaaacgaaatgctgcataaactataccccaactgcatcacagttgcagaagatgtt
tctggaatgcctgcattgtgtttacctttggtcctagggggcgtaggattcgactatcgt
ctagccatggctgtccctgacatgtacatcaagctgctcaaggagaagaaggatgaagag
tgggacatggcaaacatagcattcaccctcaccaaccgcagacatggcgagaaagcgatt
gcatatgccgagagccatgatcaagcgcttgtcggtgacaagacgctgatgatgtggctt
tgcgacaatgagatgtacacaaacatgtctgtgttgacggaactcactcccctcattgag
cgtggcatgagtctacataagatgatccgcctggtcacacacggacttggaggagaaggc
tacctcaacttcgagggcaatgagttcggtcaccccgaatggctcgatttcccccgtcaa
ggcaataataacagcttctggtatgccagaaggcagctgaatctcactgaggatcatctc
ctccgatacaagttcttgaacgagttcgacagaaaaatgcagctgaccgaggagatatac
gggtggctccagtcaccgcaggcctacatcagcctcaagaatgaacaggacaaggtcttg
gtatttgaacgcgccggattgctctgggtgttcaacttccatccaaccaacagttttaca
gcctaccgtgtcggagtagagcaggcaggaacgtaccggattgtcattgacactgacgac
agcgattttggaggattcgaccgcaacgccaaaggaacaaggttcttcaccacagatctg
gagtggaatgggcgcaaaaactatacagaattgtatctgcccacgagaacggccctggtg
agttccaagttcagcccttttgatccaggatga

DBGET integrated database retrieval system