KEGG   Trichophyton verrucosum: TRV_06012Help
Entry
TRV_06012         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRV_06012
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_06012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 837 aa AA seqDB search
MPPPYGPQNFQNWYPYQQMPPHPPPMQPYPQYNTPLIVCSYPRPQPPNHAPPPPHMSPAL
RTQSSTPITSHPSAFSPTPPVSLSTPAITEPQEDQSAQYSLTRSGSEVGSNASTNASTNN
SARPTPPPITARRPEARSGVRQVFQPPLPWLSVPEAPFPSKPPRRRRKNRVTQPSSLAVE
LPSKDENETEDTEPQGNDAEDQPAEPASVAQSEVDTPSLPSATVAQQTPAHARQASTTRA
GVPVVPVVPLVSQSPSASKQSKSSAQPTPEKAGTTEAAAPTVIENGHGPTEEESQPPASS
ETTSNTTPSPAPQRAAPKSWADLVRSKAAAKQSTAASPQAGALALTRGESLAEALNSFGS
NVDQYSEKIAFLEPRGLVNTGNMCYMNSIGRRAAHSFKSDSPLVDAMIMFLREFRVIDAA
SSVEKLRLRLKQNELEEYGESFIPEYVYQVIRHLPRFRDMRQDAQEFLGFLLEELHDECL
LATKNAMADKSDVSTSSDVDAHSIADDSTGDGWLEVGHKQKASVTRSSGDSSGESPITRI
FSGKIRSEFRVPGNKNSVTLEPYQSLQLDIGSPQVNNIIDALKGLTKPETMHGDFQSSRG
PKVNATKQVFIENLPPVLILHLKRFQYDNVTNGTQKIWKKIGYPLELEIPKEVFPPHRRN
ALSAQNGSLPKYRLIGVIYHHGKSASGGHYTVEVRRQDGREWVRFDDTYIRRVRSEEVAF
GGSEEDPKLLSAALERHNNSSDQTSSNNIYDQFDADEQDHSDNGRGWSQVNGSGSGSHSR
QKSMAAAAAAAAAASGNASPKADSGKGTPTASSSARFGASRDNKVAYLLFYQRIHSA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgtacggaccccagaacttccagaactggtacccgtaccagcagatgcct
cctcaccctcctccaatgcagccttacccccagtataataccccgttgattgtttgctca
tatcctcggccccaacccccgaaccacgcaccacctccaccacacatgtctccagccctc
cggacacagtccagcactcccattacatctcacccgtcggctttctcgcccacgcctccc
gtttccctgtctacaccggcaatcaccgagccgcaggaggatcagtctgcgcagtattct
ctaacccgctctggcagtgaagtgggcagcaatgcctcaaccaatgcttctaccaacaac
agtgcacgccctacaccccctccaatcaccgccagaagaccagaggctcggtcaggcgta
agacaggtattccaacctccattaccttggctttccgttccagaggctccctttccttcc
aagcctccacgacgccgccgtaagaaccgtgttactcaaccttcttccctcgccgtagaa
ttgccttcaaaggacgagaatgaaactgaagacaccgaacctcagggaaatgacgctgaa
gaccaaccagctgagccagcttctgtggcccaatccgaagtagatactccgtctctgccc
tcagccaccgtcgctcaacaaactccagcacacgcccgccaggctagcactacaagagca
ggggttccggtagttcccgttgttccattagtttcccaaagcccatcagcttccaagcaa
tccaaatcttcagctcagcctactcctgagaaagcgggtacaaccgaggcagcagctcca
acagtcattgaaaacggacatggtccaaccgaggaagaatcacagccgccagcttcctcc
gagactaccagcaacacaaccccgtctccagcaccgcaacgggctgccccaaaatcttgg
gctgatcttgttcgttcaaaggccgctgcaaaacaatcaactgctgcttctcctcaagct
ggtgccttggcgctcacccggggtgaatccttggctgaagcactcaacagctttggttcg
aatgttgatcagtatagcgaaaaaattgctttcttagaacctcgtggccttgtaaatacg
ggaaatatgtgctatatgaattctattggccgtcgtgcggcccatagcttcaaaagtgac
agccctttagtggatgctatgattatgtttctacgggaattcagggttattgatgcggca
tcttcggtggaaaaattaaggcttcggttgaaacaaaacgaattggaggagtacggcgaa
tcttttattccagaatatgtttatcaagttattcgacatctcccgcgttttagggacatg
agacaagatgcccaggaattccttggcttccttctcgaagagctccatgatgaatgcctc
ttggccactaaaaatgccatggcagacaagtctgacgtttctacttcgtctgatgtggat
gctcattccatcgcagatgattctactggtgacggctggctggaggttggccacaaacag
aaagcatcggtcaccaggtcgtccggtgatagttctggggaatcgcccattacacgtatt
ttcagcggtaaaatccgatcagagttcagggtgcctggaaacaaaaactcggtaactctc
gaaccttatcagtcccttcagcttgacattggatcccctcaggtcaacaacattatcgac
gcactcaagggccttaccaagcccgaaaccatgcatggagatttccaatcatcccgtgga
cccaaagtcaatgctaccaaacaagtcttcattgagaatctaccccctgtcctcatcctt
cacctcaagcgtttccagtatgataacgtcaccaatggcacgcaaaagatctggaagaag
attggatacccacttgaactggagatacccaaggaggtctttcccccacaccgccgcaat
gccctttctgcccagaacggcagcctccccaaataccgcctcattggagttatctatcat
catggcaagagcgcaagtggagggcattacacagttgaagtccgccggcaggatggacgt
gaatgggtccgttttgacgacacctacatccgccgcgtacgaagtgaagaagtggccttt
ggcggtagtgaagaggatccaaaactgctctctgccgcccttgagcgccacaataattct
agtgaccaaacttccagcaacaacatctatgaccaatttgatgctgacgagcaagaccac
tcagataacgggagaggttggagccaagtcaatggctctggctcaggcagccactctagg
caaaaatccatggccgccgctgccgccgctgctgctgctgctagcggtaatgcctcgcct
aaagccgactccggaaaaggcacccccacagcttccagcagcgcccgtttcggcgcttct
cgagataacaaagttgcatatctcctgttttaccagcgtattcacagcgcttaa

DBGET integrated database retrieval system