KEGG   Trichophyton verrucosum: TRV_06101Help
Entry
TRV_06101         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tve  Trichophyton verrucosum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1434 aa AA seqDB search
MTQEVERTPGSSQSKTVRVSFEATADPQASNLGIQPSTSSNGGHHRSATSGAVQFPSSSR
SIDDAGQDSHSSANESRPRSRPNINGNRRKPALIRAKSEHWHDLGPDVRALGGEEEDVQL
RHGWQEEYTSSEYLKVLNSFLVLTMAALQNFYMYFTEKRHDTNGIPKQPDEVWRSQDWRM
RDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSTTGAQNKVMEQIGKKLQEQ
YETLSLRTRYKQYLDPSVEETKKFCISLRRNAKDERVLFHYNGHGVPLPTPSGEIWVFNK
NYTQYIPVSLYDLQTWLAGPSLFVFDVSHAGNIVQNFHAFLEKHEKENAEARKRDPIASL
QNYGDCILLAACEKNETLPTNPDLPADLFTCCLTTPIEIALRYFVLQNPLQTSLCVDEFR
VPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMVAALFRNFLLSERIM
RTHECHPISSPKLPITHTHPLWQSWDLAVEMVLAQLPALIEQEEGTRHYEYQHSPFFAEQ
LTAFEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSGFLDLGPWAVHLALSIGI
FPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITILHPNSPIPVAN
VSDHRAMCAFIVAIFCKQYPQGQHVCLSPELIEACLTHLLDTENPLLRQWSCLCLSMLWN
DFPEAKWMGIRASAPPKLCELAADPVPEVRAAMLHALTSFIGIPDLTDQVAQIEEYLAMA
VLPMGSDGSVLVRKEFLVFVSTFVKRYQNKFIVAAYEQLLEEKQVLTTQPTGSPLMSPPQ
PSENGVSQGTVIGSIWKLVLILSVDPHPDVAQDGGIIVDYVHKTLLESPLGGLARKARED
ILELYTRAQSKKTQQQESIDNARPKTPPSQQAPKPEGYLSLSLRRTASVAASLKNMAFGS
SSNSPQPPGSPNSTTFAKPQVPKGRVTVTPRGRAPAEWTRPPEVNDQRASARSYQQAPTP
SSRGFKLRDVKEEPVIPLVSQFLDWSTEYFREPQMKPNEPDEPGSSDYNERLWRRGRNER
IIVETQPMKTRAGSSRWDNSVSLINNSTQPMKMCFHQFEDHLAVADDRDTICIWDWQSNT
YLNRFSNGNPLGSKINEVRFINEDDQALLMTGSSDGVLKLFRSYESSKNVKVLTAFRALP
ELIPSNKNAGLVLEWQQGQGKALVAGDVKVIRYGYTLQPIVHVITNSQIQDISARSGSCI
TSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNVHMQRGGVRELV
SGSRNGEVRLWDLRMDHSIESTQATKDTLRTLGVHEHAPVFTMYVCPYLINPFGAKLTCC
LLAEPIAVKSRHSMLTALIYLPSNLIAAFCTIPDPPQSSALYSILIKCSWLARL
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaggtagagagaactcctggctcgagccagagcaagacggtccgagtgtct
ttcgaggctaccgccgacccgcaagcttccaatctgggcatccaaccgtctacgtctagc
aacggaggtcaccatagatcagccaccagtggcgccgtccagttccctagtagttcgagg
tcaattgatgacgctggacaagactcacattcctctgcgaacgagtcgaggccgcgctcg
aggcctaatatcaacggcaacaggcggaagcctgctctgattcgggcaaaaagtgaacat
tggcatgaccttggtcctgatgtcagggctttaggaggtgaggaagaagatgttcagctc
cgccatggctggcaggaggaatacacctccagtgaatacttgaaggtcttgaactctttc
cttgtgctgacaatggctgctctgcagaacttttacatgtattttactgaaaagcgacat
gataccaatggcatcccgaaacaaccggacgaagtctggagaagccaggattggcgcatg
agagatagactgaagactgtctccgctgcacttgctatctgcctcaacatcggagtagat
ccaccagatgtagtcaaaacaaacccctcagcgaaactcgaatgctgggtagatccaact
tccacgaccggagcgcagaataaggttatggaacagattggaaagaagctacaggaacag
tacgaaacactcagtctgcgcacacgatacaagcagtacttggacccctcggtggaggaa
acgaagaaattttgtatttccctccgacgaaatgcaaaggatgaaagggttctctttcat
tacaacggtcacggagtcccgctgcccacaccttctggcgaaatctgggtattcaacaag
aactacactcaatatatccctgtctccctttacgacctgcagacatggcttgctggtccc
agcttgtttgtattcgatgtttctcatgcgggtaacattgttcaaaacttccatgccttt
ctcgaaaagcatgagaaggaaaatgcggaagctcgcaagagagatcctattgcatccctc
caaaattacggcgattgcattctccttgctgcttgtgagaaaaacgaaaccttgccaaca
aaccctgacctccctgcagatctcttcacctgttgtcttaccacccctatcgagatagcc
ttgaggtactttgtgcttcaaaatccactgcaaacaagtctttgtgtggatgaatttagg
gttccgggacgcctacaggatagaagaagtccgctgggtgaacttaattggatattcacg
gcaattacagataccattgcttggaacacccttcctcgccccctattcaagaagctcttc
cgacaagacctcatggttgctgctttgtttcggaatttcctactcagcgaacgtatcatg
agaactcacgaatgtcatccaatttcttcaccgaaactgcccattacacatactcacccg
ttgtggcaaagctgggatttggctgttgaaatggtcctggctcaacttccggctctcatt
gaacaagaagaaggcaccagacactacgaataccagcattccccattctttgctgagcaa
cttacggcttttgaggtgtacctctcttccgggcctacagaaaagaacccaccagatcaa
ctccctattgtcctccaggttttgctcagtcaagctcaccggttaagggcattgattctc
ttgagtgggttccttgacctcggcccgtgggctgttcacctcgctcttagcatcggtata
ttcccttatgttgtcaaactactccaaagtgctgcccaggagcttaagcctgtcatggtc
ttcatctgggccaggataatggcagttgatcatacagtacagaatgatctcctcaaagac
aatggcatccactactttattaccatactccatcctaattctcccatacccgttgcaaat
gtcagcgatcacagggccatgtgtgcgtttattgttgctatcttctgcaagcagtaccct
cagggacagcatgtttgtttgtccccggaactaattgaggcatgtttgactcacctattg
gatactgaaaaccccttactacggcaatggtcatgtttatgcctcagtatgctgtggaat
gacttcccggaggcaaagtggatgggtattcgtgcttctgcgccacccaagctctgcgaa
cttgcagccgaccctgttccagaagttagagcagcaatgctccatgccctcaccagcttc
attggcatcccagaccttaccgatcaagtagcccagatcgaagagtatctcgctatggca
gtactcccaatgggctctgatggtagcgttcttgtgcgaaaggaattcctggttttcgta
tcaacttttgtcaaaagatatcaaaataaattcatagttgcagcatatgagcagctattg
gaagagaagcaggtcctaacaactcaacccaccggatccccgctaatgtcccctcctcaa
ccatctgagaatggtgtttctcaaggcactgtgatcggttcaatttggaagctggttctt
atcttatctgtcgatccgcatccagacgtcgcgcaggatggcggcattatcgttgactat
gtccacaaaactcttctagaatcaccgctcggtggtttggctaggaaagcaagggaggac
attctggaattatatacccgcgctcaatcaaagaaaacacaacaacaggagtccattgat
aacgctagacccaagacccctccgagccaacaagcacccaagccagaaggatatctctcc
ctaagcttaagaaggacagctagtgtcgctgcatcccttaaaaatatggcctttggctct
tcatcaaatagtcctcagcctccaggctcccccaactccactacgtttgctaaaccccaa
gtgccgaagggccgtgttacagttacgcctaggggtcgcgcacctgctgagtggactcgg
cctccagaggtcaatgaccagcgtgcctccgctagatcataccaacaagcacctacccca
tcttctagaggatttaaacttagagatgtgaaagaagaacctgttattccattggttagt
cagttcttagattggtcaacagagtatttccgagaaccccaaatgaaacctaatgaaccg
gatgagcccggtagttcagactataacgaacgcctctggcgacgaggcaggaatgaaaga
atcattgttgaaacgcagccaatgaagactcgagctggtagttctcgctgggataactcg
gtttctctcataaacaactccactcagccaatgaagatgtgtttccaccaattcgaagac
catcttgcagtggctgacgatagggacacaatatgtatctgggattggcaatcaaataca
tatctcaaccgattctcgaatggcaaccctctagggtcaaaaattaatgaagtccgtttc
attaacgaagatgaccaagctcttttaatgacaggctcctctgacggcgtattaaaacta
ttccgcagctacgaatcgagtaaaaatgtcaaggttctcacagcgttccgcgctttgcct
gagttgatacccagtaataaaaatgccggactcgtccttgagtggcaacaaggtcaaggc
aaagcgctagtagcgggggatgtgaaggttatccgatacggttataccctccaacctatt
gtccatgtcataactaacagtcaaatccaggatatatctgctcgctccggatcatgcatt
acgtccctgacctccgaccaagtagcgggtaacatcttcgttgcaggatttggcgatggt
gcagttcgtgttttcgaccagcgcctgaaaccaaccacggcaatggttaaggtctggaga
gaacacaaacagtggattaccaacgtacacatgcaacgaggcggagtcagagaattggtc
tccggtagccgcaatggtgaagtccgactctgggatctaagaatggatcactcgatcgaa
tcaacgcaggcaaccaaagacaccctgcgtaccctaggtgttcatgaacacgccccggtt
ttcaccatgtatgtctgcccctatctcatcaacccctttggagctaaactaacatgttgc
ttgttagcggaaccaatcgccgtgaagtcaagacattcaatgttgacggcactcatctat
ctaccttcgaacctcatagcagctttttgcaccatacccgatcctccccagtcgtcagca
ctgtattccatcctcataaaatgctcctggcttgctcgactctaa

DBGET integrated database retrieval system