KEGG   Trichophyton verrucosum: TRV_06101Help
Entry
TRV_06101         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
tve  Trichophyton verrucosum
Pathway
tve04136  Autophagy - other
tve04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:tve00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    TRV_06101
   04136 Autophagy - other eukaryotes
    TRV_06101
Membrane trafficking [BR:tve04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    TRV_06101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N WD40 Peptidase_C14 HEAT_2 HEAT Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 9584564
NCBI-ProteinID: XP_003019813
UniProt: D4DFZ9
AA seq 1434 aa AA seqDB search
MTQEVERTPGSSQSKTVRVSFEATADPQASNLGIQPSTSSNGGHHRSATSGAVQFPSSSR
SIDDAGQDSHSSANESRPRSRPNINGNRRKPALIRAKSEHWHDLGPDVRALGGEEEDVQL
RHGWQEEYTSSEYLKVLNSFLVLTMAALQNFYMYFTEKRHDTNGIPKQPDEVWRSQDWRM
RDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSTTGAQNKVMEQIGKKLQEQ
YETLSLRTRYKQYLDPSVEETKKFCISLRRNAKDERVLFHYNGHGVPLPTPSGEIWVFNK
NYTQYIPVSLYDLQTWLAGPSLFVFDVSHAGNIVQNFHAFLEKHEKENAEARKRDPIASL
QNYGDCILLAACEKNETLPTNPDLPADLFTCCLTTPIEIALRYFVLQNPLQTSLCVDEFR
VPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMVAALFRNFLLSERIM
RTHECHPISSPKLPITHTHPLWQSWDLAVEMVLAQLPALIEQEEGTRHYEYQHSPFFAEQ
LTAFEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSGFLDLGPWAVHLALSIGI
FPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITILHPNSPIPVAN
VSDHRAMCAFIVAIFCKQYPQGQHVCLSPELIEACLTHLLDTENPLLRQWSCLCLSMLWN
DFPEAKWMGIRASAPPKLCELAADPVPEVRAAMLHALTSFIGIPDLTDQVAQIEEYLAMA
VLPMGSDGSVLVRKEFLVFVSTFVKRYQNKFIVAAYEQLLEEKQVLTTQPTGSPLMSPPQ
PSENGVSQGTVIGSIWKLVLILSVDPHPDVAQDGGIIVDYVHKTLLESPLGGLARKARED
ILELYTRAQSKKTQQQESIDNARPKTPPSQQAPKPEGYLSLSLRRTASVAASLKNMAFGS
SSNSPQPPGSPNSTTFAKPQVPKGRVTVTPRGRAPAEWTRPPEVNDQRASARSYQQAPTP
SSRGFKLRDVKEEPVIPLVSQFLDWSTEYFREPQMKPNEPDEPGSSDYNERLWRRGRNER
IIVETQPMKTRAGSSRWDNSVSLINNSTQPMKMCFHQFEDHLAVADDRDTICIWDWQSNT
YLNRFSNGNPLGSKINEVRFINEDDQALLMTGSSDGVLKLFRSYESSKNVKVLTAFRALP
ELIPSNKNAGLVLEWQQGQGKALVAGDVKVIRYGYTLQPIVHVITNSQIQDISARSGSCI
TSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNVHMQRGGVRELV
SGSRNGEVRLWDLRMDHSIESTQATKDTLRTLGVHEHAPVFTMYVCPYLINPFGAKLTCC
LLAEPIAVKSRHSMLTALIYLPSNLIAAFCTIPDPPQSSALYSILIKCSWLARL
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaggtagagagaactcctggctcgagccagagcaagacggtccgagtgtct
ttcgaggctaccgccgacccgcaagcttccaatctgggcatccaaccgtctacgtctagc
aacggaggtcaccatagatcagccaccagtggcgccgtccagttccctagtagttcgagg
tcaattgatgacgctggacaagactcacattcctctgcgaacgagtcgaggccgcgctcg
aggcctaatatcaacggcaacaggcggaagcctgctctgattcgggcaaaaagtgaacat
tggcatgaccttggtcctgatgtcagggctttaggaggtgaggaagaagatgttcagctc
cgccatggctggcaggaggaatacacctccagtgaatacttgaaggtcttgaactctttc
cttgtgctgacaatggctgctctgcagaacttttacatgtattttactgaaaagcgacat
gataccaatggcatcccgaaacaaccggacgaagtctggagaagccaggattggcgcatg
agagatagactgaagactgtctccgctgcacttgctatctgcctcaacatcggagtagat
ccaccagatgtagtcaaaacaaacccctcagcgaaactcgaatgctgggtagatccaact
tccacgaccggagcgcagaataaggttatggaacagattggaaagaagctacaggaacag
tacgaaacactcagtctgcgcacacgatacaagcagtacttggacccctcggtggaggaa
acgaagaaattttgtatttccctccgacgaaatgcaaaggatgaaagggttctctttcat
tacaacggtcacggagtcccgctgcccacaccttctggcgaaatctgggtattcaacaag
aactacactcaatatatccctgtctccctttacgacctgcagacatggcttgctggtccc
agcttgtttgtattcgatgtttctcatgcgggtaacattgttcaaaacttccatgccttt
ctcgaaaagcatgagaaggaaaatgcggaagctcgcaagagagatcctattgcatccctc
caaaattacggcgattgcattctccttgctgcttgtgagaaaaacgaaaccttgccaaca
aaccctgacctccctgcagatctcttcacctgttgtcttaccacccctatcgagatagcc
ttgaggtactttgtgcttcaaaatccactgcaaacaagtctttgtgtggatgaatttagg
gttccgggacgcctacaggatagaagaagtccgctgggtgaacttaattggatattcacg
gcaattacagataccattgcttggaacacccttcctcgccccctattcaagaagctcttc
cgacaagacctcatggttgctgctttgtttcggaatttcctactcagcgaacgtatcatg
agaactcacgaatgtcatccaatttcttcaccgaaactgcccattacacatactcacccg
ttgtggcaaagctgggatttggctgttgaaatggtcctggctcaacttccggctctcatt
gaacaagaagaaggcaccagacactacgaataccagcattccccattctttgctgagcaa
cttacggcttttgaggtgtacctctcttccgggcctacagaaaagaacccaccagatcaa
ctccctattgtcctccaggttttgctcagtcaagctcaccggttaagggcattgattctc
ttgagtgggttccttgacctcggcccgtgggctgttcacctcgctcttagcatcggtata
ttcccttatgttgtcaaactactccaaagtgctgcccaggagcttaagcctgtcatggtc
ttcatctgggccaggataatggcagttgatcatacagtacagaatgatctcctcaaagac
aatggcatccactactttattaccatactccatcctaattctcccatacccgttgcaaat
gtcagcgatcacagggccatgtgtgcgtttattgttgctatcttctgcaagcagtaccct
cagggacagcatgtttgtttgtccccggaactaattgaggcatgtttgactcacctattg
gatactgaaaaccccttactacggcaatggtcatgtttatgcctcagtatgctgtggaat
gacttcccggaggcaaagtggatgggtattcgtgcttctgcgccacccaagctctgcgaa
cttgcagccgaccctgttccagaagttagagcagcaatgctccatgccctcaccagcttc
attggcatcccagaccttaccgatcaagtagcccagatcgaagagtatctcgctatggca
gtactcccaatgggctctgatggtagcgttcttgtgcgaaaggaattcctggttttcgta
tcaacttttgtcaaaagatatcaaaataaattcatagttgcagcatatgagcagctattg
gaagagaagcaggtcctaacaactcaacccaccggatccccgctaatgtcccctcctcaa
ccatctgagaatggtgtttctcaaggcactgtgatcggttcaatttggaagctggttctt
atcttatctgtcgatccgcatccagacgtcgcgcaggatggcggcattatcgttgactat
gtccacaaaactcttctagaatcaccgctcggtggtttggctaggaaagcaagggaggac
attctggaattatatacccgcgctcaatcaaagaaaacacaacaacaggagtccattgat
aacgctagacccaagacccctccgagccaacaagcacccaagccagaaggatatctctcc
ctaagcttaagaaggacagctagtgtcgctgcatcccttaaaaatatggcctttggctct
tcatcaaatagtcctcagcctccaggctcccccaactccactacgtttgctaaaccccaa
gtgccgaagggccgtgttacagttacgcctaggggtcgcgcacctgctgagtggactcgg
cctccagaggtcaatgaccagcgtgcctccgctagatcataccaacaagcacctacccca
tcttctagaggatttaaacttagagatgtgaaagaagaacctgttattccattggttagt
cagttcttagattggtcaacagagtatttccgagaaccccaaatgaaacctaatgaaccg
gatgagcccggtagttcagactataacgaacgcctctggcgacgaggcaggaatgaaaga
atcattgttgaaacgcagccaatgaagactcgagctggtagttctcgctgggataactcg
gtttctctcataaacaactccactcagccaatgaagatgtgtttccaccaattcgaagac
catcttgcagtggctgacgatagggacacaatatgtatctgggattggcaatcaaataca
tatctcaaccgattctcgaatggcaaccctctagggtcaaaaattaatgaagtccgtttc
attaacgaagatgaccaagctcttttaatgacaggctcctctgacggcgtattaaaacta
ttccgcagctacgaatcgagtaaaaatgtcaaggttctcacagcgttccgcgctttgcct
gagttgatacccagtaataaaaatgccggactcgtccttgagtggcaacaaggtcaaggc
aaagcgctagtagcgggggatgtgaaggttatccgatacggttataccctccaacctatt
gtccatgtcataactaacagtcaaatccaggatatatctgctcgctccggatcatgcatt
acgtccctgacctccgaccaagtagcgggtaacatcttcgttgcaggatttggcgatggt
gcagttcgtgttttcgaccagcgcctgaaaccaaccacggcaatggttaaggtctggaga
gaacacaaacagtggattaccaacgtacacatgcaacgaggcggagtcagagaattggtc
tccggtagccgcaatggtgaagtccgactctgggatctaagaatggatcactcgatcgaa
tcaacgcaggcaaccaaagacaccctgcgtaccctaggtgttcatgaacacgccccggtt
ttcaccatgtatgtctgcccctatctcatcaacccctttggagctaaactaacatgttgc
ttgttagcggaaccaatcgccgtgaagtcaagacattcaatgttgacggcactcatctat
ctaccttcgaacctcatagcagctttttgcaccatacccgatcctccccagtcgtcagca
ctgtattccatcctcataaaatgctcctggcttgctcgactctaa

DBGET integrated database retrieval system