KEGG   Trichophyton verrucosum: TRV_06130Help
Entry
TRV_06130         CDS       T01615                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRV_06130
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_06130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 952 aa AA seqDB search
MSNELIIEAYRQQNRIIPSRNSYHFRCLRSIGHWRDPVDGKTINDFVELETTNGKYADDD
VPDSYSYFNLDYYRDFALSDDSIIGSFYARLEDTQNDMEPRKHLWRIGDYRKSEKIKAAA
EESACLSFILVNFPLCIKLIHVLGVTTAEQAEVFLGVHADTPDDFVISMYTAKISDSPDS
KEVAKRAVRLIADSRKSEALQHFLKTGEAASAQMDIGDAFRLLQIPDRSVDDAAIIAAYS
VCCSEAPEQIDTYRQALAVIAEESGSAVIRSMLLDDSAPANRALLDWPVGLRNIGNTCYL
NSLLQFYFTIQPFRNMVLDLDRYKTELDEEVIRNKKVGSRKVSLLEIQRSQKFLVQLKAL
FNDMITSPDAFVTPTQELARLTLLSSSSEAAFRRKSLSTHKISELGEINGMPIMGPVGPP
APIPEEKSTPSSSSPEKEESAKEDVGVTPSTGASNELESGNASDQTVVPTVETKEVTSSS
SETSITPEHPVSEAIVAPNRPPPVPPRPAPRVDNEQLIREEVELGAQQDVTEVINNVLFQ
AQCAIKPTKIDADGNQMDLIMDLFYGQTKSYITAMNGIRSKNEFWSDIKVDVATGSRDIY
SAIDGAFDRQKVHVDGADAEQYGAISKIPPVLQIQVQRVQFDQVKKSSFKSTHHLELKET
IYMDRYMDVPEHDNMGLYKRRREKWAWNDELNGLKVRREELLSNNESLPDLFQDARDKVQ
DLMLMKDDPEMGNDALDIDEGVLAHLSNLEVMTRKELIRIDSRIEQLAHLIDNQFNDMKS
LPYHLYAVFIHHGSVEFGHYYIYIFDFEKKIWRKYNDSEVTEVHSTAEIFSDRNVKNPPT
PYFLVYLNDGLKERLAKPVCRHIEERPAQTTSAADNSKSKPGRERAGDRSDVEMTDLPPS
YDEAQKTAPDEKAILTGPAAMAKKKLSPSPDRKRLKRKGAESEEHPTVASKN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgaactgatcattgaagcctatcgccagcaaaacagaattataccatcacga
aatagctaccatttcagatgcttacggtcaattggacactggagagaccctgtcgatggc
aagacaataaatgattttgttgagttagaaacaacgaacggcaagtatgccgacgatgat
gtacctgattcttactcatatttcaaccttgactattaccgagactttgctctaagcgat
gattccatcatcggatcgttctatgctcggcttgaagatactcaaaatgatatggagcca
cgaaaacatctctggagaataggcgactaccgcaagagcgaaaagataaaggccgctgca
gaagagagtgcgtgtctttccttcattcttgttaatttccccctttgcataaagctaata
catgtcctaggagtgacgaccgctgagcaagctgaagtattcctgggagtccatgctgat
acccctgatgatttcgtgatttcgatgtatactgcaaagattagcgatagtcctgacagc
aaagaggtagctaaacgagctgttcgacttatcgcagatagccgaaagtctgaagcccta
caacattttctcaagacgggcgaagcagcctctgcccaaatggatattggggatgcattc
cgtttgctccagatccccgatagatcggtagatgatgctgctataatagctgcatactca
gtatgttgctcggaagctcccgaacagatcgatacatatcgacaagcacttgctgttatt
gccgaggagagtggcagcgcggttatccgtagcatgctgcttgacgatagcgccccggcg
aaccgcgcactgttggactggccggtcggacttcgaaatattggtaacacctgttacctg
aacagtttgcttcaattttactttaccatccagcctttccggaatatggtactggatctt
gaccggtataaaactgaacttgatgaggaggtgattcggaataaaaaggttggatcgcga
aaagtatctcttttagagatccaacgctcacagaaattccttgtgcaattgaaagctctg
ttcaacgacatgattacttcccctgatgcgttcgtaacaccgacccaagagcttgctagg
ctgacgttgctcagttcctcaagtgaagctgcgtttcggcgtaaatctctatcaactcac
aagatatcagagttaggggagattaatgggatgcccatcatgggccctgtcggtcctcca
gctccaatccctgaagagaagtctacaccgagtagcagctctccagaaaaggaggagtcg
gctaaagaagatgttggcgtcaccccttctacaggagcttccaatgagctagagtctggc
aacgcttcagaccaaactgtggtgcctactgttgaaacaaaagaagtcacctcatcctcc
agcgagaccagtattacacctgagcacccggtatcagaggctattgtagcccctaacaga
ccaccaccagttcctccacggcctgctccacgggttgacaacgagcagctaattcgagaa
gaagttgagttgggtgcccagcaggacgtcacggaagttatcaacaacgtgctcttccaa
gctcagtgcgcaattaagccaaccaagatcgacgcagacgggaatcagatggatttgatc
atggatctgttctatggacagaccaaatcttacatcactgcaatgaatggtatacgttct
aaaaacgagttctggtcagatatcaaagtcgatgtcgccactggctcgagagacatctat
tctgctattgacggtgcttttgatagacaaaaagtacatgttgatggtgcggacgcagaa
cagtatggagccatcagcaagatcccaccagtactacaaattcaagtgcagcgtgtgcag
ttcgatcaggttaagaagtcatctttcaaatccactcaccatttagagctaaaggaaaca
atatacatggaccgatacatggacgtcccggaacatgataatatgggtctatataaacga
cgccgagaaaagtgggcatggaacgacgagcttaatgggttaaaagttcggcgggaggag
ctactaagcaacaatgaatccctccccgacctttttcaagatgcccgtgacaaagtccaa
gacttgatgttgatgaaagacgatcctgaaatgggaaatgatgccctagacatcgatgaa
ggggtattggcacacctttcgaatttggaagtaatgacaagaaaggaactcattcgcatt
gattctcggatagaacaacttgcccatttgatagataatcagttcaacgatatgaagtct
ctcccctaccatctctatgcggtattcattcatcatggatccgtggaattcggtcactac
tacatttacatatttgactttgaaaagaagatatggcgaaagtataacgattccgaagta
accgaggtccacagcacggcagaaatctttagtgatcgcaacgttaagaacccgccaacc
ccctacttccttgtttatctaaacgacgggttaaaggaacgactggccaaacctgtgtgt
cgtcacattgaggagcgtccggcacagaccacctcggcggcagataattcaaaatcaaaa
cccggccgagaacgtgcaggtgacagatcggatgtagagatgaccgacctacctcccagc
tatgacgaggcgcaaaaaacagccccagacgagaaagccattttgacgggcccagctgcg
atggcgaagaagaagctatcgccatctccagaccgcaagcgattaaaacgaaagggcgcc
gaaagtgaggaacacccgactgttgcatcgaagaactaa

DBGET integrated database retrieval system