KEGG   Trichophyton verrucosum: TRV_06208Help
Entry
TRV_06208         CDS       T01615                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tve  Trichophyton verrucosum
Pathway
tve00062  Fatty acid elongation
tve00071  Fatty acid degradation
tve00280  Valine, leucine and isoleucine degradation
tve00310  Lysine degradation
tve00380  Tryptophan metabolism
tve00410  beta-Alanine metabolism
tve00640  Propanoate metabolism
tve00650  Butanoate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01130  Biosynthesis of antibiotics
tve01200  Carbon metabolism
tve01212  Fatty acid metabolism
Module
tve_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TRV_06208
   00650 Butanoate metabolism
    TRV_06208
  Lipid metabolism
   00062 Fatty acid elongation
    TRV_06208
   00071 Fatty acid degradation
    TRV_06208
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TRV_06208
   00310 Lysine degradation
    TRV_06208
   00380 Tryptophan metabolism
    TRV_06208
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRV_06208
Enzymes [BR:tve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TRV_06208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 9583666
NCBI-ProteinID: XP_003019745
UniProt: D4DGA4
AA seq 291 aa AA seqDB search
MFARRCSRLVASQTARPLQSYISRFYSTGSPAYEYILTSTPKPGVGLITLNRPKALNALC
SPLFKELNEALTKYDEDKSTGAIIITGSEKAFAAGADIKEMTPLTFAAAYNDNFIAPWSH
LANTIRTPVIAAVSGYALGGGCELAMMCDMIYCTDKATFGQPEIKLGTIPGAGGSQRLTK
LVGKSKAMELILTGNTFSGKEAGQWGVAAKVVEGGKDELMEATLETASKIASYSRVAVVA
AKEVVNKSQELSLKEGVEFERRLFHGLFGSKDQKIGMTAFAEKKKPEWSHE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccagacgctgctcaagactcgtggcctcgcagactgcccggccattgcagtcc
tacatctcccgcttctactcgaccggatccccagcctacgagtacatcctcacgtctact
cctaagcccggtgttggattaattactcttaaccgaccaaaggctctcaatgccttgtgt
agccctctcttcaaggagctcaacgaggccctcaccaagtatgacgaagataagagcact
ggtgctataatcatcaccggcagcgagaaggcatttgcagccggtgccgatatcaaggaa
atgacccctctcaccttcgctgccgcctacaacgacaacttcattgctccttggtcgcat
cttgccaacacaatccgaactcccgtcattgctgcggtctccggatatgctctcggaggc
ggctgcgagctcgcgatgatgtgtgatatgatctactgtacggacaaggccaccttcgga
cagccagagatcaagctcggcactatccccggagccggtggttctcagcgtctgaccaag
ctcgtcggtaagagcaaggccatggagcttatcctcactggaaataccttcagcggaaag
gaagctgggcagtggggagtagccgccaaggttgttgagggtggcaaggacgagcttatg
gaggctacccttgagactgctagcaaaatcgctagctacagccgtgttgctgttgttgct
gccaaggaggttgttaacaagagccaggagctttcgctgaaggaaggtgtcgagttcgag
agaagactgttccacggtctctttggaagcaaggaccagaagattggtatgactgctttc
gctgagaagaagaagcctgaatggtctcatgagtga

DBGET integrated database retrieval system