KEGG   Trichophyton verrucosum: TRV_06317Help
Entry
TRV_06317         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRV_06317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 676 aa AA seqDB search
MTGFAPLDAPVTNGSTDKKRIAYFYDSDVGNYAYVAGHPMKPHRIRMTHSLVMNYGLYKK
MEIYRAKPASKFEMTQFHTDEYIDFLAKVTPDNMDQYAKEQSRYNVGDDCPVFDGLFEFC
GISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRV
LYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGAGKYYSVNFPLRD
GIDDVSYKGIFEPVIKHVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVKYVKS
FNLPTLILGGGGYTMRNVARTWAYETGVLVGNQLPTELPYNDYYEVSFSDYPTLYAGCVL
TVFQYFSPDYELDVRPSNMDNANSKEYLEKIRMQVVENLRRTTFAPSVQMTDVPRDPLVD
GMDDEADAILDDLDEDENKDKRYTKRRFDNYVEKDGELSESEDEESAAANGVRRQPNRER
RRGNINHRHLDGDSIIDSGIVTPRDESSMPEEEPEQADKMDETENAEPPAKPSPPAVEPL
AKPDSQMEDDETPVAETNGAAQEVEEKEPPVSTPASNLAVPHDNADGDTTMEDADVNMDE
TIELEPPAEEQEDEAAAKAPARETTPPKPPVAEETKSNASGAENTATEPTQVTDTTEAKE
TKLDTDESKEAPKEKE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtttgcaccgctagatgctcccgttacgaatgggtccacggataagaagcgc
attgcctacttctatgactccgatgtgggcaattatgcctacgtcgctgggcaccccatg
aagcctcatcgcattcggatgacccacagcttggtgatgaactatggactttataaaaag
atggagatatatcgcgcgaaacccgccagcaaatttgagatgacgcagtttcataccgat
gaatacatagattttcttgccaaagttacacccgataatatggaccagtacgcgaaggag
cagagccgttataatgttggtgatgactgccccgtttttgacggtctttttgagttctgt
ggaatcagcgcaggaggctctatggaaggtgctgcgcgcctcaacagaaataaatgcgac
attgcagtcaactgggcaggtggtcttcatcacgcaaagaaaagtgaagcaagcggtttt
tgttacgttaacgacattgttctcggcattctcgagcttctgcgtttcaaacagcgtgtt
ctttatattgatattgatgtccaccatggcgatggtgtcgaggaagcattttatactacc
gaccgcgttatgacggtctcattccataaatatggagaatacttccccggaaccggcgaa
ctgcgcgacattggtgtcggtgcagggaagtattattctgtcaactttcctctcagagat
ggcatagatgacgtttcttataaaggcatctttgaaccggttatcaaacatgttatggaa
tggtaccgcccagaggctgtcgtccttcagtgcggtggtgatagtttgtctggtgaccgt
ctgggatgtttcaacttgagtatgcgcggccatgcgaactgcgttaaatacgtcaaaagc
ttcaacctccctacattaatcctgggcggtggtggttacacaatgagaaacgttgctcga
acatgggcatatgaaactggtgtgcttgttggaaatcagcttccaacagagcttccatat
aacgactattatgaagtaagtttttcagattatccaacactctatgcaggctgcgtgctt
actgtatttcagtacttttctcctgactatgaattggatgttcggccatcgaacatggat
aatgccaactccaaggagtacctggaaaagattcgaatgcaagttgttgaaaatctacgg
cgcactacgtttgctccatcagtccaaatgacagatgtcccgagggacccattagttgat
ggtatggatgacgaagcggatgctatcctcgatgaccttgatgaagatgaaaataaggat
aagagatatacaaaacgacgatttgacaactacgtcgaaaaagatggcgaactaagcgag
agtgaagatgaagaatccgcagctgcaaacggtgtccgtcgtcagcccaatagagaaagg
aggcgagggaatatcaatcaccgtcacctggatggggactccattatagacagtgggatt
gttactcctcgagacgagtcatccatgccggaggaggagcctgagcaggctgataagatg
gacgaaacagaaaatgcagaacctcctgccaagccctctcctcctgccgttgaaccttta
gccaagccagattcacaaatggaggatgatgagactcccgtcgccgaaaccaacggtgcc
gcccaagaggtcgaggagaaagagcctcccgtttccacacctgcctcgaatctagcagtc
cctcatgacaatgctgacggggacaccaccatggaagacgcagatgttaatatggacgaa
actatcgagctagaacctccagccgaagaacaagaggatgaagctgctgcaaaggctcct
gcacgggagacgacacccccaaaacccccagtggctgaagaaaccaagtcgaatgcttct
ggggcagaaaacactgcgacagagcctacgcaggttactgataccacggaagccaaggaa
acaaagcttgatactgatgagtctaaggaggctccaaaagagaaagagtaa

DBGET integrated database retrieval system