KEGG   Trichophyton verrucosum: TRV_06349Help
Entry
TRV_06349         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tve  Trichophyton verrucosum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRV_06349
   01230 Biosynthesis of amino acids
    TRV_06349
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRV_06349
   00030 Pentose phosphate pathway
    TRV_06349
   00051 Fructose and mannose metabolism
    TRV_06349
   00052 Galactose metabolism
    TRV_06349
  Energy metabolism
   00680 Methane metabolism
    TRV_06349
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TRV_06349
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TRV_06349
Protein phosphatases and associated proteins [BR:tve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TRV_06349
Messenger RNA biogenesis [BR:tve03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TRV_06349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 778 aa AA seqDB search
MAAPTPVAAPAKQRRIAVLTSGGDAPGMNGAVRAVIRMSIHCGCEAYAVHEGYDGLVQGG
DYFRQMFWEDVRGWLSRGGTLIGSARCKAFREREGRLKAAKNMVIRGIDALIVCGGDGSL
TGADIFRSEWPGLLEELVKNGELSSKQIEPFKSLNIVGLVGSIDNDMSLTDATIGCYSSL
HRICEAVDEVFDTASSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDGWEDD
MCDIITQNRRRGKRRTIVIIAEGAQDSHLEKITSNKVKDILSDRLQLDTRVTVLGHTQRG
GAACAYDRWLATLQGIEAVKAVLEAKPGSPSPIITIRENKIERTSLVEAVRVTKSVSEAI
AKKDFATAMALRDSEFMALHRAYINTTTPHHPKLLLPEAKRMRIAIIHVGAPAGGMNPAT
RGAVAYCLARGHTPIGIYNGFPGLCRHHDDKPLGSVREVKWLESDSWVNEGGSEIGTNRG
LPSEDMETTAKCFELYKFDALFVIGGFEAFTAVSQLRKARKDYDAFKIPMIQLPATISNN
VPGTEYSLGSDTCLNTLVNFCDVIRQSASSSRRRVFVIETQGGRSGYIATIAGLSVGAYA
VYIPEEGISIKMLANDIENLRKSFATDRGANHAGKIILRNERASATYTTQVIADMIKEEA
KGRFESRSAVPGHFQQGGKPSPMDRIRALRMSLKCIQHFEEYADKSPDEIAADDMSTVVI
GIRGSEVVFSPLGGKDGLEATDTDWEHRRPKNEFWLKFREMVDTLSGRPDGNYKTDDA
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccctacgccagtggcagctccggctaagcagcgccgcatcgccgttctaact
agtgggggggatgcgcctggaatgaacggggccgtgagagccgttatccgcatgtcgatt
cactgtggttgcgaggcctacgctgttcacgaagggtacgatggtctagtgcagggaggg
gactactttaggcaaatgttctgggaggatgtccggggatggctgtctcgtggaggaaca
ttgatcgggtctgcaaggtgcaaggccttcagagagcgtgaggggaggctaaaagccgct
aagaatatggttattcgtgggattgatgcccttattgtgtgtggcggtgatggctcgctg
actggagctgatatctttcgctccgagtggcccggtctactggaagagctggtgaagaat
ggagagctcagctcaaaacagattgagcccttcaagtcgttgaatattgttggactggtg
ggctctattgacaatgacatgtccttaacagatgctaccattggctgttactcgtccctg
caccggatctgtgaggctgtggacgaggtctttgataccgcttcttcccatcagcggggt
tttgttatagaggtcatgggtaggcattgtggatggttggcattgatgtctgccatcagt
accggagcggactggctgtttattcccgagatgcctccccgagacggctgggaggatgac
atgtgtgatatcatcactcagaaccgacgaagaggtaaacgacgaactattgttatcatt
gctgagggagcccaggacagtcatcttgaaaagatcacgtccaataaggtcaaagatatt
ctcagtgatcggctgcagctcgacacccgagtcactgtcctagggcatacacaacgaggt
ggcgcagcctgtgcctatgaccgatggctagctacactccagggcattgaagctgtcaag
gctgtcctggaagccaagccgggctccccttcgccaatcatcactatccgagagaacaag
atcgaaaggacctccttagtcgaggctgtaagggttacgaaaagtgtctctgaggccata
gcgaagaaggactttgctactgccatggcactgcgtgactctgaattcatggctctccac
agagcatatatcaacactaccacaccacaccatccaaaactgctacttccagaagcgaag
agaatgcgtattgctattattcatgtcggagctccagctggtggaatgaaccccgctacc
cgaggtgccgtagcatactgtctggctcgcggccacactcccattggaatctacaatggc
ttcccaggtctctgtaggcatcatgacgataaacccctgggctctgtcagagaggtcaaa
tggctcgagtcggactcgtgggtcaacgagggtggctcagaaattggtactaaccgtggc
ctcccatcagaggacatggagaccactgcaaaatgctttgagctctataaatttgatgcc
ttatttgtcatcggaggctttgaagcattcactgctgtaagccaattgcgaaaagcaaga
aaggactatgatgccttcaagatcccgatgatccagctacctgctactatctccaacaac
gtccccggaacagaatactccctaggaagtgatacttgtctcaacaccctggttaacttt
tgcgatgtcattagacagtcagcttcctcctctcgacgtcgagtgtttgttattgagacg
caaggaggacgatctggttacattgccaccatcgctgggttgtccgtcggcgcgtacgca
gtgtatatccccgaagagggtatcagtatcaagatgcttgccaacgacattgagaatcta
cgaaaaagctttgctaccgaccgcggtgccaaccacgctggcaagattatcctacgcaac
gagcgagcgtccgccacatacaccacccaagtgatagccgacatgatcaaggaagaggct
aagggacgattcgaatcccgctctgctgtcccaggtcacttccagcaaggcggaaagccc
tctcccatggaccgtatccgcgcccttcgcatgtctctcaaatgcattcaacatttcgaa
gagtatgctgacaagagcccggacgagatcgcggcagacgacatgtctaccgtcgtcatc
ggcattcgaggtagcgaggtggtcttcagcccccttggtggtaaggatgggctggaagcg
actgacacggactgggagcaccgacggcccaagaacgagttctggctcaaattccgagag
atggtcgatactctaagcgggcgacccgacggcaactataagacggacgatgcgtga

DBGET integrated database retrieval system