KEGG   Trichophyton verrucosum: TRV_06597Help
Entry
TRV_06597         CDS       T01615                                 

Definition
histone deacetylase HosB
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRV_06597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1139 aa AA seqDB search
MADNKGKSKEKDTSGESRNVDVVALDSSNKDHLEGQDREVNEALLSAIMASPQQRSSQCS
GQEELLKSFNKLNITTMNDHNKNNNKTPSPSLSPLQSPYHKPETTHSILRNDPGARPPSR
QQQQEQRAPRRTTSTTSLRDERRSSIQSLQKRASISSLRSVQNLTASSSSPRQSLSRRSS
AQHLASSPGASGRPISPLAEMAPPPAPTASEIAAQYWSRELALHQTTELQSSTIVIIQDA
CYGHRFSRPRTSKDDLNLIVERPERMQASILGVAAAFIRMGLRYGSNEFAPHPNLDLQRL
PAPPFQIRKSVRTMSLDSPAVTHIHGTKWMEDLRLMCDAAEGRLATNGKELVRPSSSGRE
TRAKAAPQLHEWDLYLCPESLNAFEGALGGVCDAVDSVFTSPSIRRAFVCIRPPGHHCSG
SFPSGFCWLNNVHVGISYAAMTHGLTHAAIIDFDLHHGDGSQAIAWKQNERATAKNAAGC
EKTAIGYFSLHDINSYPCEEGDETKIRNASVCIDKAHGQSIWNVHMEVWKTSQEFWKIYE
TKYTILLEKARAFLRAHSLKLRSNASPNAPQPKAAIFLSAGFDGSEWEGANMQRHKANVP
TDFYARFTADVVRMAQEEDLAVDGRVISVLEGGYKDRALTSGVFSHLSGLSDCPEIKVER
DPSSSRLAAEMYRRLGLNEESKHGTSADGTSNFNYDPIWWAPALLEELEVLVNTPPTTPR
KPRGRGPPTFSAPTQASAAKVTTPTRPHRSPSSNHTREPSPPPLPRVEWATAAFELSKAL
IPTDRQIASCQHADLKVVPSQSRPASRLASAANRQQPRASERGTSHMQLRERKQKAPAAT
TGSLASSRSSTVSTRRTTIASSNDLPSTNMTGSGEPANSPSVRRSSRRISMTSTASTSPV
SSAGKINQPKTRETPLRPSPSRASSGSESQNSATRARTAVTNRAPTPVRNIPKKPQGNGG
NVDNLSASVKRLNIKLNLPSPEENAAREAKLAQDRKKGLQAASQSSQRKPASRAAPGTKT
SAKETTERQSRSNPHSTATNAKKTSPPGKPNLALSYDGAYDEDPITGHEQESLASTPNEA
TGNTNTMPSPPLTPDTAPEPETPTITVRSPPASAHQQLPVFTATSIIPFAPSQNPPSNS
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atggctgataataaaggtaaaagtaaggagaaggacaccagcggagaaagtagaaatgtg
gatgttgttgctcttgactccagcaacaaagaccaccttgagggacaagacagagaggtg
aatgaggctctactctccgccattatggcctcgccgcagcagcgttcgagccagtgcagt
ggccaggaggagctacttaagagcttcaacaagcttaacatcaccaccatgaatgatcac
aacaagaataacaacaagacaccttcaccctctctctcacccttacagtctccatatcac
aagccagagacaacccatagcatattgagaaacgaccctggcgcccgtccgccctcgcgg
cagcagcaacaggagcaacgcgccccgcgaaggaccaccagcaccacgtccctgcgtgac
gagagacgcagctcgatacagtcattgcagaagcgagcatcgatcagctcccttcgatcg
gtacagaatctgacggcctcttcatcttctccacgtcagagtctctcgcggcgttcgtcg
gcgcaacatctggcgtcgtcccctggcgcgtcagggcggcctatttcacccctcgcagag
atggcgccccctccagccccgacggcatcggaaatagctgctcagtattggagccgagag
ctggcccttcaccagactacggaactgcagtccagcactatcgtcattattcaggatgcc
tgttatggccatcgattctcgcgcccccgcaccagcaaggacgacctgaatctcatcgtc
gaacggccagagagaatgcaggccagcatcctcggtgtggctgctgcatttatccgcatg
ggccttcgttatggctctaacgagtttgcgccccacccaaacctcgacctacaacggctc
ccggctcctccgtttcagataagaaagtctgtacggaccatgtccctggactcaccagcg
gtaacgcacatccatggtaccaaatggatggaagatcttcggctgatgtgtgatgctgcc
gagggaagactggcaacgaacggaaaggagctcgttcgtcctagcagctctggtagggag
accagagccaaggccgctccacaactgcatgaatgggatctatacctctgccctgaatct
ttgaacgcgtttgaaggcgcattggggggtgtttgtgacgctgttgactcagtatttacc
tctccgtcgatacgccgcgcgtttgtctgtattcgaccaccaggtcaccattgctcaggc
agcttcccatccggcttctgctggcttaacaatgttcatgtgggtatttcatatgctgcc
atgacgcatggactcactcacgctgccattatcgactttgaccttcatcacggcgacggg
tctcaggccatcgcttggaaacagaacgagcgagctactgctaaaaatgcagccggatgt
gaaaagactgcaatcggatactttagtttgcatgatatcaactcttacccatgcgaagaa
ggagatgagactaagatccggaacgctagcgtctgtatcgataaagcccatgggcagagc
atatggaacgtccatatggaagtatggaagacctctcaggaattctggaaaatatacgag
acaaaatataccattctgctcgagaaggctcgcgcgtttctacgagctcattcccttaag
ctacgttctaatgcttcacccaacgcacctcagcccaaggccgctatcttcctctctgct
ggcttcgatggaagtgagtgggagggagccaacatgcagcgacacaaagccaacgttcca
acggacttctatgccagatttactgctgatgttgttagaatggcacaagaggaagatctg
gctgtcgatggaagagtcatctcagtcctggaaggtggatataaggacagagccttgacc
agcggtgtcttcagccatctctctggtctgtccgactgccccgaaatcaaggtcgaaaga
gatcccagcagcagccggcttgccgctgagatgtacagaagactgggcctgaatgaagaa
agcaagcatggaacttctgcagatggcacatctaactttaattatgaccctatctggtgg
gcgccagccttacttgaagagttggaagtccttgtcaacactccacctaccaccccacga
aagcctcgtgggagagggccacctaccttctctgctcccacccaagcatctgccgcaaag
gtaaccaccccaactcggccacataggtccccatcctctaatcacactcgggagccttcc
cctccgccacttccacgagttgagtgggccacagcggcttttgagctctccaaggctctc
attcctacggaccgtcagattgccagttgccagcatgcagacctgaaagtggttccaagc
cagtctcgaccggctagccgtctggcatctgcggcaaacagacaacagccacgcgccagt
gagagaggcacgagccatatgcaacttagagagagaaaacagaaagcccccgccgcgact
acaggaagtctcgcaagctcccgttcttctaccgtcagcacccgtcggactaccatcgcc
tctagtaatgatttaccgagcacaaatatgacgggtagtggggaacctgcaaattcgcct
tctgttcgccgttcttcacgaagaattagcatgacgtccactgcatctacgtctccagta
tcttcagctggaaagataaatcaacctaaaactcgtgaaacacccttgagaccttcacct
tcgcgagcaagctcggggtctgaatcacagaatagcgcaactagagctagaaccgcagtc
accaaccgagctcctacaccagttagaaatatccctaagaaacctcaggggaatggcgga
aatgtggataatttatcagccagcgtgaagaggctgaacatcaagctgaatctgcccagc
cccgaggaaaacgcagctcgagaagccaagttggcccaggaccggaaaaaagggttacaa
gcagcatcacagtcctcccaacgcaagccggcaagcagagctgctcctggaaccaagact
tccgcaaaggagactactgaaagacagtcacgttcgaatccccattctactgcaacgaat
gctaaaaagaccagcccacccggaaaaccaaatcttgccctatcctatgacggggcctac
gacgaagaccccatcacaggccatgaacaggagtcccttgcatcgacaccaaatgaggcc
acaggcaataccaacaccatgccctctcctccattgacaccagacacggcccctgagccc
gagactcctacaattacagtccgctcaccgccagcttcggcgcatcagcaactgcctgtc
ttcacagcaacatcgatcattccctttgcaccctctcagaaccctccttcgaactcttag

DBGET integrated database retrieval system