KEGG   Trichophyton verrucosum: TRV_06628Help
Entry
TRV_06628         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRV_06628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MGVPEGAQEAVGTPDPADRGFATLNTLSIGVKVFVVKDGEQRKAEILSIKQKKGGPTFYV
HYVDFNKRLDGKSFDTSNYPNPMLTMPLEWIPASRIDLTKEVEWPQPEKPEKKKISGAAA
AAAATKAQPKNLKRGQHASRDASSTPDLLSGKNQNISKAPRPSKAGGKENQEDESGTPFE
ISMLGSEGPSVSGTPRVRDGESEDVEMADIQSEVEAKATLKEEQDKLAADATREVEIEKL
RTGGSMTQNLTEIHRVRNLSKIQMGKFEIEPWYFSPYPTSFSDADMIYIDEFCLSYFDNE
RAFRRHRSKCTLLHPPGNEIYRDDHVSFFEVDGRRQRTWCRNLCLLSKLFLDHKTLYYDV
DPFLFYCMTTRDANGCHLVGYFSKEKESAEGYNVACILTLPQYQRRGFGRLLIAFSYELS
KREGKLGSPEKPLSDLGLLSYRQYWRETLVELLVEPGRDAISESELATLSAMTEKDVHET
LVVLGLLRYNKGNWVLVLTDSVMEQHKKRLEKEKIKGARNIDPSRLQWKPPVFNASSRTW
NW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcccagaaggcgcccaggaggctgttggaacgccagaccccgcggatagaggt
tttgccaccttgaatacattgagtatcggagtaaaggtgtttgtcgtcaaagatggagag
caacgaaaggctgagattctttcgataaagcagaagaaaggagggccgaccttctatgtc
cattatgtggacttcaacaagcgtcttgatggtaagtcttttgatactagtaattaccca
aatcctatgctgacaatgcctttagaatggattcctgcatcgaggatcgatcttactaaa
gaagttgaatggccccagccggagaaacctgaaaagaagaaaatatcaggggcggctgcg
gctgcggctgctaccaaggcgcaaccaaagaatctcaagcgaggacagcatgcaagcaga
gatgcttcatcaactccagatctgctgtctggtaagaaccagaacatttcaaaggcccca
agaccttcaaaggctggaggcaaagaaaatcaggaagatgaaagtggtacaccattcgag
atatccatgcttggcagcgaggggccatccgtgagtggcacacctcgagttcgtgatgga
gagtcagaagacgttgagatggccgatattcaatctgaggtcgaggcgaaggccactctg
aaggaagaacaagacaagctcgctgctgacgcaacccgggaagtcgaaattgaaaagtta
agaacagggggaagcatgactcaaaatctaacggagatccaccgtgtacggaacttgagt
aagatccaaatgggtaaattcgagattgagccgtggtacttctctccttatcctacgtcc
ttcagtgatgccgatatgatatacatcgacgaattctgcctcagctactttgacaacgaa
cgtgcgttccgcagacatcggagcaagtgcaccttactacatccaccaggaaacgagata
taccgggatgaccatgtttcattttttgaagttgacggcagacgacaaaggacatggtgc
agaaacctctgtctactcagcaagctgtttttagaccacaagacgttatactacgatgtc
gatccattcctattctactgtatgactacgcgggatgccaacggatgccatcttgtcgga
tatttttccaaggaaaaggagtccgccgaaggatacaatgttgcatgcatcctgactttg
cctcagtaccaacgtcgtgggtttggtcgactgcttatcgccttcagctatgagcttagc
aagcgggaagggaagctaggttctcctgaaaagcctcttagtgacctaggtttactgagc
tatcgccagtattggagggaaacgcttgttgaacttcttgtcgagccaggccgagacgca
attagcgagagcgagttagctacgttaagtgcaatgactgaaaaggatgttcatgagaca
ttagtggtgctaggattgctacggtataataaaggaaattgggtcctggtattaacggat
agcgtgatggagcaacataagaagcgtctcgaaaaagagaaaattaagggtgctagaaat
attgacccttcacgtcttcagtggaagccaccggtcttcaatgcctccagtagaacatgg
aactggtaa

DBGET integrated database retrieval system