KEGG   Trichophyton verrucosum: TRV_06758Help
Entry
TRV_06758         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tve  Trichophyton verrucosum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRV_06758
Enzymes [BR:tve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TRV_06758
Glycosyltransferases [BR:tve01003]
 Polysaccharide
  Storage polysaccharide
   TRV_06758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 651 aa AA seqDB search
MTERGIEIVYGRWLIEGAPRVLLIDTGAGYKYLDEWKGDLWNAAGIPSPSADSETNEAIA
FGYLVAWFLGELIFRQYICRDTERAVIAHFHEWLAGVALPLTKKRRMDVTTIFTTHATLL
GRYLCAGSVDFYNNLKNFDVDAEAGKRGIYHRYCIERAAAHSADVFTTVSHITAYESEHL
LKRKPDGVLPNGLNVKKFSAVHEFQNLHSHSKDKINDFVRGHFYGHNDFDLENTLYFFTS
GRYEYRNKGVDMFIESLARLNHRLKVSGSKTTVVAFIIMPSQTSSLTVEALKGQAVVKSL
RDTLESVEKSIGKRLFERCLGWKEGDNMPDEKDLMTNQDRVLIRRRLFAMKRHNLPPIVT
HNMINDSEDPILNQLRRVQLFNYPTDRVKVVFHPEFLNSANPVLPLDYDDFVRGTNLGVF
PSYYEPWGYTPAECTVMGIPSITTNLAGFGCYMEELIENSADYGIYVVDRRLKGVDDSVN
QLTSYMFDFCQKSRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPTSFDAAD
DFHEAIGHTEQKISRPLSVPGSPRDRTGTMTPGDFASIQEGREGLDTEDYISYKPPTSAN
GVNANTIPRAGSDDEEEDSIPVPIRPKRQSISLKLGPAPNGHGVGSETKAA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgtggcatagagatcgtatacggtcgatggctgatagaaggcgctccccgc
gtcctcctgattgatactggtgcgggatataagtatctcgacgagtggaaaggagatctt
tggaacgctgctgggattccgtcaccttcggctgattcagagaccaacgaggcaattgca
tttggatatcttgttgcgtggtttctaggagagctgattttccggcagtatatatgtcga
gacaccgagagggctgttatagctcatttccatgagtggctcgcaggagttgcgttgccc
ctgaccaagaagcggcggatggacgtaacgactatttttaccactcatgcaactcttctt
ggacgatatctttgtgctggctcagttgacttctacaacaacttgaagaactttgacgtg
gatgcagaggccgggaaacgaggaatctaccaccgctactgcatcgagcgagctgctgcc
cattctgctgatgtcttcaccacggtctctcacattaccgcctacgagagcgagcacttg
ctcaaacgaaagcccgacggagtcttgcctaatggattgaacgtcaagaaattctcggct
gttcatgagttccaaaacttgcactctcattcaaaggataagattaacgactttgttcgt
ggtcatttctacggccacaacgactttgacctggaaaataccctatattttttcacctcc
ggccgatatgagtaccgaaataagggtgtggatatgtttattgaatcgctcgcgagactt
aatcaccggctgaaggtatctggatccaagactaccgtggtagcctttataattatgcct
tcccagacctcctctctcactgttgaggctcttaagggacaagctgtggtcaaatcgcta
cgagataccctggagagcgtagaaaagagtatcgggaaacggctgttcgaacgctgtctg
ggctggaaagaaggtgacaatatgcccgatgaaaaggacctcatgacaaaccaggaccgt
gtgcttatccgtcggcgtttgtttgccatgaaacggcacaaccttcctccaattgtcact
cataatatgatcaacgactctgaagatcccatccttaatcaacttcgccgagtccaactc
ttcaactaccctactgatcgcgtcaaggtggtcttccaccccgagttccttaactctgcg
aatcctgtgctgcctttagactacgacgattttgtccgtggtactaaccttggtgttttc
ccttcatactatgagccatggggctatacccctgcagagtgcacggttatgggaatccca
agtataacaaccaaccttgctggttttggatgttatatggaagagctgatcgaaaactca
gccgattatggtatatatgtggttgacaggcgattaaaaggcgttgacgactcggtaaac
cagcttacgagctacatgttcgatttctgccagaagagcagaaggcagcgaatcaaccaa
agaaacagaacagaacgactgagtgatctgctggattggaaacgcatgggcttggaatat
gtcaaggcccgccagctcgccctcagacgtgcataccctacctcctttgatgcagcagac
gatttccacgaggctattggtcatacagaacaaaagatatctcgaccactatctgtccca
ggttctcctcgcgatcgaacgggtaccatgaccccaggggactttgcttccatacaagaa
ggccgcgaagggctggataccgaggattatatatcctacaaacctccaaccagtgccaat
ggagtcaatgctaacaccatacctagagccggcagcgatgatgaggaagaggattcgatc
cccgttcccattagaccgaaaaggcaatccatctccctcaaacttggcccagctcctaac
ggacatggagttggaagcgaaaccaaggctgcttga

DBGET integrated database retrieval system