KEGG   Trichophyton verrucosum: TRV_06770Help
Entry
TRV_06770         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRV_06770
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TRV_06770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 446 aa AA seqDB search
MVYEYLLSNNISGEFTTAPGPTSLRSMHLNFWTTSCIKANFPYNPFSHPFRIYGIEMLSQ
VYSKLDDLAIPSFMLFLGDFIYIDVPLQFGSAIKHYRDEYQKVYASPSWHTGKNPAINLP
WIHMLDDHEIQNDWHDGNVTEPYPAAIEPYHHYHVSVNPPKAKSPHASQENTTYFSFTRG
PASFFILDSRTYRSPPGLDNSTMLGYAQLQSLLDYISCPEPAPVKWKIISSSVPFTKNWH
IGTSDTWGGYLKERQILLEAMWRAERTLGTRIVLLSGDRHEFAATKFPNPATKQTDSSSS
SLSKGEGQGIYEFCAGPLNQFYLPSSSYYQTDDEDVTIKYIPNGNFKFGAVGIDIHPDGG
SDLTYTLYVNSEAVWQYKLSMPSDIKAGEAEFPDGEEVFDLVSRPKGKLDMGVLMFWRGL
YWLNSQVSNLVEGVNGLILKKERLDE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatgagtacctgctatccaacaacatatccggagagttcaccaccgccccagga
ccaacctccctaaggtcaatgcatctcaacttctggacgacaagctgtatcaaggcgaat
tttccgtacaatccattctcccacccattcaggatttacggaatcgaaatgctttcccaa
gtgtactctaagctggatgacctggccataccttcgttcatgcttttcctgggagacttc
atctacatcgatgtgcctctgcagttcggctctgccatcaagcattacagagacgaatac
caaaaggtctacgcatctccaagctggcacacgggtaagaatcccgccataaaccttccc
tggatccacatgcttgatgaccacgagatccagaatgattggcacgacggcaatgtcact
gagccataccctgccgccattgagccttaccaccactaccatgtgagcgttaaccctcca
aaggcaaagtcccctcacgcatctcaggagaacacgacatatttctccttcactcgggga
cctgcgtcattcttcatcctggactcaagaacataccgttcccctcctggactggataac
tcaactatgctcggatacgcgcaacttcaatccctactagattacatctcctgccctgaa
cccgcaccggtgaaatggaagataatcagtagcagcgtgccatttaccaagaactggcac
atagggacatccgatacttggggaggatatttgaaggaacgtcaaattctcctggaggcc
atgtggcgagctgaacgtactctcggtactagaatcgtccttcttagcggtgacagacac
gaatttgctgccacgaaattccccaaccctgctacaaagcagactgactcctcatcttca
tccctttccaaaggcgaaggtcagggtatatatgaattctgcgccggccccttgaaccag
ttctaccttcccagcagttcctactaccagactgatgatgaggatgtaaccatcaagtat
attccaaacggcaacttcaagttcggcgccgtgggtattgacattcatccagatggaggg
tctgacctaacatatacattatacgtgaactctgaagctgtatggcaatacaagctctca
atgccttcagatataaaagcaggggaagcggagttccctgacggtgaggaggtgtttgac
ttggttagccgtccaaaggggaaactagacatgggagttcttatgttttggcgaggacta
tactggctaaattcacaggtcagcaatcttgtagagggggtgaatgggttaattctgaaa
aaggaaaggctagatgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system