KEGG   Trichophyton verrucosum: TRV_06784Help
Entry
TRV_06784         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRV_06784
Transcription machinery [BR:tve03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TRV_06784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MDKTELEQPCPAESQQNHKRPAPEELSIAPDAKRNKAIDGGPTVPDSNISTIVRRAPFPN
KVFHSPLSPAPFPPSLKYKICANNIVKPAVLEEQRGEIEYRVVNNDGSRESTIILTGLKC
LFQKQLPEMPKAYIARLVYDRAHVSLALVKMPLEVIGGISYREFRARKFAEIVFCAISAK
HQVKGYGAHLMAHLKDYIRATSPVMHFLTYADNYAIGYFQKQGFTKDITLEESVWMGYIK
DYEGGTLMQCTMLPRMRYLEASRMLLKQKECVQAKIRTFNTSDVVHQPPEQWANSHGDIA
PIDPLSIPAIRATGWSPDMDELSRMLPRRGPYFKELRHFLTLMRNHKSAWPFAHPVNKNE
VPDYYNIIKSPMDLSTMEERLEHGYYTTPKVLFDDLKLIFSNCRKYNSEYSIFVKCAQQL
ERYMRKIVMEIPEWQKFLEE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaacagagttggagcaaccatgtccagctgagagccagcagaatcacaagcgg
ccggctcccgaagaactttctatcgcccctgacgccaaaagaaacaaagctattgatggc
gggccgacagtgccggattccaacatttctactattgttcgacgggctcctttccccaac
aaagtattccattcccccctctctcccgctcccttccccccatctctcaaatacaaaata
tgtgctaacaacattgtcaagcctgcagtgctggaagaacagagaggcgagatagagtac
cgggtagtcaacaatgacggttccagagaaagtacaattattctcacgggtcttaaatgc
ctattccaaaaacaactcccagaaatgcctaaagcttatatcgcacgtctcgtttacgac
cgtgctcatgtgtccctagcccttgttaagatgccccttgaggttattggcggaatatcg
tatcgggaattccgcgctcgcaagtttgccgaaatagtgttttgtgcaatatccgctaag
catcaagtaaaaggatatggggcgcaccttatggcccatctgaaggattatatcagagct
acctccccagtgatgcattttttaacttacgctgataattatgccattggctactttcag
aaacagggtttcacaaaggatattactctcgaagagtctgtctggatggggtatatcaaa
gactacgaagggggaacgcttatgcaatgcacaatgcttccccgaatgaggtaccttgaa
gctagccgtatgctccttaagcagaaggagtgtgtccaggccaagatacgtacctttaac
accagtgatgttgtccatcagccacctgagcagtgggctaatagccacggtgacatcgcc
ccaatcgatccactctctatccctgcaattcgtgcaactggttggtctcctgacatggac
gagttatcacggatgctgccacgccgcgggccttattttaaggaactccggcatttttta
actcttatgcgaaaccacaaaagcgcatggccctttgctcaccctgttaacaaaaatgaa
gtccccgattattacaacattattaaatcgcccatggatctgtcgacgatggaagaacga
ttggagcatggttactacactactccaaaggtcctttttgacgatcttaagctgattttc
agtaactgtcgaaagtataatagtgaatactcgatattcgttaaatgtgcacagcagctg
gagaggtacatgcggaagatcgtcatggaaattccggaatggcagaagtttcttgaagaa
tag

DBGET integrated database retrieval system