KEGG   Trichophyton verrucosum: TRV_06933Help
Entry
TRV_06933         CDS       T01615                                 

Definition
hypothetical protein
Organism
tve  Trichophyton verrucosum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 620 aa AA seqDB search
MVFGLFQVQSLSLAHKGRQTLRQTPADPGLFSPGDRVIPADSLSLPLAVSISARSRAFRR
GLLSLSNSLYIAVFGCTSPTLVGFLPPLICPWSKSSHTHSATMADAFKARSLKRKNVKGL
ALNAAASKPGLKPSDGDAQIPGAIGNVDSNRTDTLEIGLEFKLDLRSEDLIVLKELGAGN
GGTVSKVMHASTKVVMARKIIRVDAKEKVRKQILRELQVGHDCNSAQIVTFYGAFQNEAR
DIVLCMEYMDCGSLDHISKNFGPVRVDVLGKITESIFAGLVYLYEAHRIMHRDIKPSNVL
VNSRGSIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAYSVRSDVWSAGLTVMELA
VGRFPFDTSDTSAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPKILDDFVAKCLLKK
PEERPTPRQLYDHDAFILAAKRTPVNLREWAISMMEQHNRKSYLAPPAPKAITRDGGSGE
SPSSSGPHTPDETPRQATSGEIPLNIAGDITPRSRPQATYGIEHSPSMGFEKLSLNTNQG
QNYSSGSVPRSSRSPYPHSATSTSQGPFAAPRPAPSPVYHTTRNGSQSAGLPHLAGPPPK
GPLPIPPTSDSWRSQSQNRI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggtttttggtctctttcaggtacaatcactctcgctcgctcacaagggcagacagacc
ctccgccagacacccgcagatccaggcctattttcccctggagatcgtgttataccagca
gactctctctctctcccccttgctgtctcgatatctgctcgctcgagagccttccgtcgt
ggtcttctctctctctctaactccctctatattgcggtgttcggctgcacctcgcctacc
ctcgtcggttttctacctcccttgatttgtccctggagcaaatcctcacatacacactct
gccaccatggcggacgctttcaaggcccgctcgctgaaacgaaagaacgtcaaggggctt
gctctcaatgcagcagcgtcaaagccaggcctgaagccctcggatggcgatgctcagatc
cccggagctatcggaaacgtggactccaacaggacagacaccctcgagattggcctggaa
ttcaaactcgacctgcgcagtgaggacctgattgtgctcaaggagctcggggccggcaat
ggagggaccgtcagcaaggtcatgcacgcctcgacaaaggtcgtcatggccagaaagatc
atcagagtcgatgcaaaggagaaagtacggaagcagatcctcagagagctccaggtcggc
cacgactgcaattcggcccagatcgtcacattctacggagcattccagaacgaagccaga
gatattgtactttgcatggaatacatggactgcggatctctagaccacatctcgaagaac
tttggccccgtcagagtcgacgtactgggaaaaatcaccgagtccatcttcgctggtctc
gtctatctctatgaagcccaccggatcatgcacagagacatcaagccatcaaacgtccta
gtaaactcaagaggaagcatcaagctgtgtgactttggcgttgctaccgagacagtcaat
tccatagcagatacattcgtcggtacttccacttacatggcaccagaacgtatccaggga
ggcgcatactctgtacggtccgacgtctggagtgctgggttgaccgtcatggaactggct
gttggaaggttccccttcgacacctctgatacctctgccggagacagggcgagtgcggga
cccatgggcatcctcgacctgctccagcagattgtacatgaaccagctcccaaactaccc
aagagtgatgcctttcccaagatattggacgactttgttgcaaagtgtctactgaagaag
cccgaagaacgaccaactccacgacagctatacgaccacgatgcattcattctagcggct
aagagaacccccgtcaatcttcgggagtgggcaatcagcatgatggagcagcacaacaga
aaatcataccttgcaccccctgcccccaaggctatcacccgcgatggcggatcaggcgaa
tctccgtcctcctccggccctcataccccagacgagaccccccgccaggctacctcagga
gaaatcccgctcaacatcgcaggagatatcacgccccgatcacggccccaagccacctac
ggcatagagcactctccatcaatgggcttcgagaagctatcactcaacaccaaccagggc
cagaactactctagcggctcggttcctcgctcctcccgctctccgtatcctcactccgct
acatccacgtctcagggcccctttgctgcgcctcgtcccgcaccttcaccagtgtaccat
actaccaggaacggttcgcagtccgccggtcttccacacctagctggtcctccgccaaag
ggccccttacccataccccctacatctgactcctggcgaagccagtcgcagaaccggata
tga

DBGET integrated database retrieval system