KEGG   Trichophyton verrucosum: TRV_06933Help
Entry
TRV_06933         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
tve  Trichophyton verrucosum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tve00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TRV_06933
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     TRV_06933
Protein kinases [BR:tve01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   TRV_06933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 620 aa AA seqDB search
MVFGLFQVQSLSLAHKGRQTLRQTPADPGLFSPGDRVIPADSLSLPLAVSISARSRAFRR
GLLSLSNSLYIAVFGCTSPTLVGFLPPLICPWSKSSHTHSATMADAFKARSLKRKNVKGL
ALNAAASKPGLKPSDGDAQIPGAIGNVDSNRTDTLEIGLEFKLDLRSEDLIVLKELGAGN
GGTVSKVMHASTKVVMARKIIRVDAKEKVRKQILRELQVGHDCNSAQIVTFYGAFQNEAR
DIVLCMEYMDCGSLDHISKNFGPVRVDVLGKITESIFAGLVYLYEAHRIMHRDIKPSNVL
VNSRGSIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAYSVRSDVWSAGLTVMELA
VGRFPFDTSDTSAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPKILDDFVAKCLLKK
PEERPTPRQLYDHDAFILAAKRTPVNLREWAISMMEQHNRKSYLAPPAPKAITRDGGSGE
SPSSSGPHTPDETPRQATSGEIPLNIAGDITPRSRPQATYGIEHSPSMGFEKLSLNTNQG
QNYSSGSVPRSSRSPYPHSATSTSQGPFAAPRPAPSPVYHTTRNGSQSAGLPHLAGPPPK
GPLPIPPTSDSWRSQSQNRI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggtttttggtctctttcaggtacaatcactctcgctcgctcacaagggcagacagacc
ctccgccagacacccgcagatccaggcctattttcccctggagatcgtgttataccagca
gactctctctctctcccccttgctgtctcgatatctgctcgctcgagagccttccgtcgt
ggtcttctctctctctctaactccctctatattgcggtgttcggctgcacctcgcctacc
ctcgtcggttttctacctcccttgatttgtccctggagcaaatcctcacatacacactct
gccaccatggcggacgctttcaaggcccgctcgctgaaacgaaagaacgtcaaggggctt
gctctcaatgcagcagcgtcaaagccaggcctgaagccctcggatggcgatgctcagatc
cccggagctatcggaaacgtggactccaacaggacagacaccctcgagattggcctggaa
ttcaaactcgacctgcgcagtgaggacctgattgtgctcaaggagctcggggccggcaat
ggagggaccgtcagcaaggtcatgcacgcctcgacaaaggtcgtcatggccagaaagatc
atcagagtcgatgcaaaggagaaagtacggaagcagatcctcagagagctccaggtcggc
cacgactgcaattcggcccagatcgtcacattctacggagcattccagaacgaagccaga
gatattgtactttgcatggaatacatggactgcggatctctagaccacatctcgaagaac
tttggccccgtcagagtcgacgtactgggaaaaatcaccgagtccatcttcgctggtctc
gtctatctctatgaagcccaccggatcatgcacagagacatcaagccatcaaacgtccta
gtaaactcaagaggaagcatcaagctgtgtgactttggcgttgctaccgagacagtcaat
tccatagcagatacattcgtcggtacttccacttacatggcaccagaacgtatccaggga
ggcgcatactctgtacggtccgacgtctggagtgctgggttgaccgtcatggaactggct
gttggaaggttccccttcgacacctctgatacctctgccggagacagggcgagtgcggga
cccatgggcatcctcgacctgctccagcagattgtacatgaaccagctcccaaactaccc
aagagtgatgcctttcccaagatattggacgactttgttgcaaagtgtctactgaagaag
cccgaagaacgaccaactccacgacagctatacgaccacgatgcattcattctagcggct
aagagaacccccgtcaatcttcgggagtgggcaatcagcatgatggagcagcacaacaga
aaatcataccttgcaccccctgcccccaaggctatcacccgcgatggcggatcaggcgaa
tctccgtcctcctccggccctcataccccagacgagaccccccgccaggctacctcagga
gaaatcccgctcaacatcgcaggagatatcacgccccgatcacggccccaagccacctac
ggcatagagcactctccatcaatgggcttcgagaagctatcactcaacaccaaccagggc
cagaactactctagcggctcggttcctcgctcctcccgctctccgtatcctcactccgct
acatccacgtctcagggcccctttgctgcgcctcgtcccgcaccttcaccagtgtaccat
actaccaggaacggttcgcagtccgccggtcttccacacctagctggtcctccgccaaag
ggccccttacccataccccctacatctgactcctggcgaagccagtcgcagaaccggata
tga

DBGET integrated database retrieval system