KEGG   Trichophyton verrucosum: TRV_06950Help
Entry
TRV_06950         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tve  Trichophyton verrucosum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tve01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tve00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tve00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 524 aa AA seqDB search
MTSVEAQLRGVAILGPLNDQTRKILTKEATAFLALLHRTFNGTRKALLKRRIDRQAEIDR
GALLDFLPETKHIRDNDTWKAAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWENMVNGQVNLYDAIRRQVDFTLGGKEYKLRTDRKLPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAQELVKRGAGPYFYLPKMESHLEARLWNDVFNTAQDYIGM
PRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRNNPNFVLPDR
ASVTMTVPFMDAYVRLLIKTCHKRGVHAMGGMAAQIPIKNDTKANDIAMESVRADKLREV
RAGHDGTWVAHPALASIASNVFNEYMPTPNQLFVRREDVHVTANDLLNTNVPGNITESGI
RKNLNIGLSYMEGWLRGVGCIPINFLMEDAATAEVSRSQLWQWAKHNVPTAEGKRVDKAY
ALKLLKEQADELSAKGPKGNKYQLAARYFSGQVTGEDYADFLTT
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtggaagctcagctcaggggtgttgccatcctcgggcccctcaacgaccag
actcgcaagatcctgaccaaggaggctacagctttcctcgccctccttcatcgcacattt
aatggcacccgcaaggccctgttgaagagacgtattgaccgccaggccgaaattgataga
ggcgcccttctcgatttcctgcctgagactaagcacatccgcgacaatgatacatggaag
gctgctccccccgcaccgggacttgttgatcgtcgtgtcgagattacgggcccaaccgac
aggaagatggttgtcaatgctttgaatgccgatgtttggacctacatggccgactttgaa
gactcatctgctccaacatgggagaacatggtcaatggtcaggtgaacctttacgatgcc
atccgccgtcaggtagacttcaccctcggcggcaaggagtacaaactccgcaccgatagg
aagctccccacactcattgcccgtgctagaggctggcaccttgatgagaagcatttcact
gttgatggagaaccaatctccggcagtttgtttgactttggtctgtacttcttccacaat
gcccaggagcttgttaagcgaggcgctggcccatacttctacctgcccaagatggaatct
cacttggaagcccgtctgtggaacgatgtcttcaacaccgctcaggactacatcggtatg
cctcgaggtactatccgaggtaccgtcctcattgaaaccatcactgctgcctttgagatg
gacgagatcatttatgaattgagagaccacagctctggcttgaactgtggacgatgggat
tacatcttctccttcattaagaagttccgtaacaaccccaactttgtccttcccgaccgc
gcctctgtcaccatgaccgtacctttcatggatgcatacgtgaggctgttgatcaagacc
tgccacaagcgaggtgttcacgccatgggtggtatggctgctcaaatccctatcaagaat
gataccaaggcaaatgacattgccatggagagtgttcgtgcagataagctccgtgaagtc
cgtgctggccacgacggaacctgggttgcccacccagctcttgcatccattgcatccaac
gtctttaacgaatacatgcccacccctaaccagctctttgtccgacgagaggatgttcac
gtcaccgccaatgatctcttgaacactaacgttccaggaaacatcaccgagtctggcatc
aggaagaacctgaacatcggtctttcttacatggagggatggctccgtggagtcggctgt
atcccaatcaacttccttatggaggacgctgctactgctgaagttagccgaagtcagctc
tggcagtgggccaagcacaatgttcccaccgctgagggaaagagagttgacaaggcatat
gcactcaagctgctcaaggagcaagctgatgaactttctgccaagggtccgaaaggcaac
aagtaccagctcgctgcccgctacttctccggtcaagttactggagaggactatgctgat
ttcttgaccacgtaa

DBGET integrated database retrieval system