KEGG   Trichophyton verrucosum: TRV_06950Help
Entry
TRV_06950         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tve  Trichophyton verrucosum
Pathway
tve00620  Pyruvate metabolism
tve00630  Glyoxylate and dicarboxylate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01200  Carbon metabolism
Module
tve_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TRV_06950
   00630 Glyoxylate and dicarboxylate metabolism
    TRV_06950
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TRV_06950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 9582109
NCBI-ProteinID: XP_003018939
UniProt: D4DIE2
AA seq 524 aa AA seqDB search
MTSVEAQLRGVAILGPLNDQTRKILTKEATAFLALLHRTFNGTRKALLKRRIDRQAEIDR
GALLDFLPETKHIRDNDTWKAAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWENMVNGQVNLYDAIRRQVDFTLGGKEYKLRTDRKLPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAQELVKRGAGPYFYLPKMESHLEARLWNDVFNTAQDYIGM
PRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRNNPNFVLPDR
ASVTMTVPFMDAYVRLLIKTCHKRGVHAMGGMAAQIPIKNDTKANDIAMESVRADKLREV
RAGHDGTWVAHPALASIASNVFNEYMPTPNQLFVRREDVHVTANDLLNTNVPGNITESGI
RKNLNIGLSYMEGWLRGVGCIPINFLMEDAATAEVSRSQLWQWAKHNVPTAEGKRVDKAY
ALKLLKEQADELSAKGPKGNKYQLAARYFSGQVTGEDYADFLTT
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtggaagctcagctcaggggtgttgccatcctcgggcccctcaacgaccag
actcgcaagatcctgaccaaggaggctacagctttcctcgccctccttcatcgcacattt
aatggcacccgcaaggccctgttgaagagacgtattgaccgccaggccgaaattgataga
ggcgcccttctcgatttcctgcctgagactaagcacatccgcgacaatgatacatggaag
gctgctccccccgcaccgggacttgttgatcgtcgtgtcgagattacgggcccaaccgac
aggaagatggttgtcaatgctttgaatgccgatgtttggacctacatggccgactttgaa
gactcatctgctccaacatgggagaacatggtcaatggtcaggtgaacctttacgatgcc
atccgccgtcaggtagacttcaccctcggcggcaaggagtacaaactccgcaccgatagg
aagctccccacactcattgcccgtgctagaggctggcaccttgatgagaagcatttcact
gttgatggagaaccaatctccggcagtttgtttgactttggtctgtacttcttccacaat
gcccaggagcttgttaagcgaggcgctggcccatacttctacctgcccaagatggaatct
cacttggaagcccgtctgtggaacgatgtcttcaacaccgctcaggactacatcggtatg
cctcgaggtactatccgaggtaccgtcctcattgaaaccatcactgctgcctttgagatg
gacgagatcatttatgaattgagagaccacagctctggcttgaactgtggacgatgggat
tacatcttctccttcattaagaagttccgtaacaaccccaactttgtccttcccgaccgc
gcctctgtcaccatgaccgtacctttcatggatgcatacgtgaggctgttgatcaagacc
tgccacaagcgaggtgttcacgccatgggtggtatggctgctcaaatccctatcaagaat
gataccaaggcaaatgacattgccatggagagtgttcgtgcagataagctccgtgaagtc
cgtgctggccacgacggaacctgggttgcccacccagctcttgcatccattgcatccaac
gtctttaacgaatacatgcccacccctaaccagctctttgtccgacgagaggatgttcac
gtcaccgccaatgatctcttgaacactaacgttccaggaaacatcaccgagtctggcatc
aggaagaacctgaacatcggtctttcttacatggagggatggctccgtggagtcggctgt
atcccaatcaacttccttatggaggacgctgctactgctgaagttagccgaagtcagctc
tggcagtgggccaagcacaatgttcccaccgctgagggaaagagagttgacaaggcatat
gcactcaagctgctcaaggagcaagctgatgaactttctgccaagggtccgaaaggcaac
aagtaccagctcgctgcccgctacttctccggtcaagttactggagaggactatgctgat
ttcttgaccacgtaa

DBGET integrated database retrieval system