KEGG   Trichophyton verrucosum: TRV_06961Help
Entry
TRV_06961         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tve01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tve00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 596 aa AA seqDB search
MLRSVSRQLPRALRKPTPAFPTIRCISSTSLRMAPQLPAVRPPVSSALPADSYQLLSTAE
KAGAAEDALFEEQIKAVNEWWASDRYEGIKRPYSAEAVVSKRGALQQTYPSSLMARKLFN
LLNERAAEGKPVHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTSTNEVSPDFGDYPYN
TVPNQVQRLFKAQNMHDRKHWDARRKLSPEERKNTPYIDYMRPIIADGDTGHGGLTAVMK
LAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIAEHINRLVAARFQWDIMGTENLLI
ARTDSESGKLLSSTIDVRDHEFILGVTEDGDPLAETLQKMELEGASGAEIDVYEAQWVKK
HKLVTFDEAVDQHLIAEGASESVRNEYKSHVEQNRDLSISARRELAAKYTKNPVFWSWDI
PRTREGFYHYRAGNEAATKRAIAFAPYADLLWVETGDPNVSKAADFAGKIRKQFPGKKLV
YNLSPSFNWMGQGFTEQTLKSFIWDLAEHGFILQLISLAGLHYNATMATELSRGFKEDGM
LSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGIVGSILSGSSSNKSMGEGNTEDRK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgctcagtgtcacgccagctgccgcgagctctccgcaagccgacacccgcattc
cccacgatccgctgcatctccagcaccagcctgcgaatggccccccagctacccgctgta
cgccctcccgtctcatcggcgcttccagcagactcatatcagctcctatcgaccgctgag
aaagctggtgctgccgaagatgccctgtttgaagagcaaatcaaggccgtaaacgagtgg
tgggcatccgacagatatgagggtatcaagaggccatactccgctgaggcggtggtgagc
aagcgaggagctttgcaacagacatatcccagctcgttgatggcgaggaaactcttcaac
ttgctgaacgaacgagctgcggagggcaaaccagtccacactctgggagcaattgacccc
gtacagatgacccaacaagcaccaaaccaggaggtgctttatatatcaggatgggcatgc
tcatcgcttcttacctccacgaacgaagtctcgccggactttggagactacccatacaac
accgtgccaaatcaggtacaacgcctgttcaaggcccagaacatgcacgacaggaaacat
tgggatgccaggcgaaagctctcgccagaagagcgcaagaataccccatacatcgattac
atgcgccctattattgcagatggtgatactgggcacggcggcctcaccgcagtcatgaaa
ctagccaaattgtttgccgagaacggcgccgcagccgtacactttgaggatcaattgcac
ggcggcaagaagtgtggtcatcttgctggcaaggttctcgtaccgattgcggagcatatt
aacagattggttgcggcccggttccagtgggatattatgggcaccgagaaccttcttata
gcacgaacagattcagagagtggtaagttgctgagcagcactatcgacgtgcgggatcac
gaatttatcctcggtgtgacggaggacggtgaccccttggccgagacgctccagaaaatg
gagttggagggcgcatctggcgcagagatcgatgtttacgaagcccagtgggttaagaaa
cataaactggttacattcgatgaagccgtggaccaacacctcatcgctgaaggtgcctct
gagtcagttagaaatgaatataaatcgcatgttgagcagaaccgtgatctttcgatctct
gctcgccgggagttggcagccaaatacacaaagaaccccgtcttctggtcctgggacatc
ccacgcacccgcgaaggcttctatcattaccgtgctggcaatgaggcagctaccaagcgt
gctattgcatttgccccctatgcagacctcctgtgggttgagaccggagaccccaacgtt
agcaaagctgccgactttgctggcaagatccgcaaacaattccctggcaagaagttggtg
tacaacttgagcccctcgttcaactggatgggacaaggattcaccgagcagacccttaaa
tcatttatttgggatttggcagagcacggattcattctccaacttatctccctcgctggt
ctgcactacaatgccacaatggctactgagctgtctcgtggattcaaggaagatggcatg
ctatcttacgtcaatttggtgcagaaacgcgaaaaggagatgggtgttgatgtacttaca
catcagaaatggagcggagcgccgtatgtcgacggtattgtgggatctatcctcagcggt
agcagctcaaacaagagcatgggtgaaggaaacactgaagaccgtaagtaa

DBGET integrated database retrieval system