KEGG   Trichophyton verrucosum: TRV_07104Help
Entry
TRV_07104         CDS       T01615                                 

Definition
uroporphyrinogen-III synthase (UroS), putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tve  Trichophyton verrucosum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TRV_07104
Enzymes [BR:tve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TRV_07104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MSLLPVTKEIPIYFLKTKSTPHDGYEEYFSPSKGFKPCFIPVLEHKFNHNNLQKVKDLIL
SGAVAKQYGGIIFTSQRAVEGFSRMVQDEVGREEAGTGEKLSGLILAHYNGLRRNTSDGN
GPSRGIREKLPLLFLVGEQHRDIIPKTLMSPSLDEEERIGVATMVVYETGVMESFGQDFV
AALEMEERANKANISAGNTSPHKQLIWVVVFSPSGCKVMLQQLGLLEEDQPEEHTSSVQA
PGKKRTPSRWSRFDYRIATIGPTTRDHLVSNFGVQPDVCAEKPSPGGLWEGIEPIIEEWK
MSREQDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctctattacccgttaccaaagagatcccgatatatttccttaaaacaaaatcaact
cctcatgatggctacgaggagtacttttcgccgtccaaaggcttcaagccgtgtttcatc
ccggtcttggaacacaaattcaaccacaataacctacaaaaggtgaaagacttgatcctc
tcgggtgccgtggctaaacagtatggcggaataatattcactagccagagagcagttgaa
ggattctctcggatggtacaggatgaggtagggagggaagaggcaggcactggagagaaa
ctctctggcctgattctcgcccattataacggtctacggcggaatacatcagatgggaat
gggccttcgagaggtataagggaaaagctacctcttcttttccttgttggcgaacagcat
cgtgatataataccgaagacactcatgtcgccgtctctagacgaagaggagcgcatcgga
gttgctacgatggttgtctatgagaccggagtcatggagagctttgggcaggattttgta
gcagctcttgagatggaggaacgcgctaataaggccaatatatctgcgggaaataccagt
ccgcataaacagttaatatgggttgtggtcttctcaccttcagggtgtaaggtaatgctg
caacaattaggactcctagaggaagatcaaccagaagaacatacgtcttcagtacaggcc
cctggaaagaagaggacaccgagcaggtggtcaaggtttgactatcgaattgcaaccatt
gggccgactacgagggaccatttggtctccaattttggggtccaaccggacgtatgtgct
gagaagccttcccctggcggtctgtgggagggaattgaacctattatagaagagtggaaa
atgtctagagagcaagacagatga

DBGET integrated database retrieval system