KEGG   Trichophyton verrucosum: TRV_07116Help
Entry
TRV_07116         CDS       T01615                                 

Definition
(RefSeq) pyruvate carboxylase, putative
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
tve  Trichophyton verrucosum
Pathway
tve00061  Fatty acid biosynthesis
tve00620  Pyruvate metabolism
tve00640  Propanoate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01212  Fatty acid metabolism
Module
tve_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TRV_07116
   00640 Propanoate metabolism
    TRV_07116
  Lipid metabolism
   00061 Fatty acid biosynthesis
    TRV_07116
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    TRV_07116
Enzymes [BR:tve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     TRV_07116
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TRV_07116
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TRV_07116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp_3 ATPgrasp_Ter Biotin_carb_N ATP-grasp Antiterm
Motif
Other DBs
NCBI-GeneID: 9581492
NCBI-ProteinID: XP_003018848
UniProt: D4DIV5
AA seq 2165 aa AA seqDB search
MAGRGHASENPKLPESLAASPKKIIFIGPPGNAMRSLGDKISSTIVAQHAGVPCIPWSGT
GVDEVKIDEEGIVTVEDNVYDQGCTHSPEDGLKKAREIGFPVMVKASEGGGGKGIRKVDS
EENFEALYNAAASEIPGSPIFIMKLAGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQK
IIEEAPVTVAKQTTFQEMEKAAVRLGRLVGYVSAGTVEYLYSHADDKFYFLELNPRLQVE
HPTTEMVTGVNLPAAQLQIAMGLPLHRIRDIRLLYGVDPNTSSPIDFGFSNEESTMVQRR
PQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFG
HIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLLETPAFEDNTITTGWLDELIT
KKLTAERPDPMVAVICGAMTKAHLASEACESEYRKGIEKGQVPAKDVLSTVFPIDFIYEG
SRYKFTATRSSIDSYHLYINGSKCTVGVRALADGGLLILLDGRSHNVYWKEEAAATRLSV
DGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHIRAGEAFAEVEIMKMYMPLIAQEDGV
VQFIKQPGATLEAGDILGILALDDPSRVKHASPFTGQLPELGPPQVLGNKPPQRFMVLLK
ILQDILLGYDNQVIMGSTLNELVQVLRNPELPYGEWNAYASALHSRMPQKLDAQMTQVID
RAKARKADFPAAQLLKTVTRFIDENVKAAADAEALRTTIAPLLQIIERYKDGLKVQEYKI
IVSLLEQYWEVERLFAQGNTRDESVILKLRDENKDDISKVIQIVLSHSKIGSKNNLILAI
LDMYRPNKPNVGNVANYLKAILRKLAELESRATAKVALKAREVLIQCALPSLEERVAQME
HILRSSVIESKYGETGWDHREPDLNVLKEVVDSKYTVFDVLPLFFAHNDQWVSLAALEVY
VRRAYRAYALKGIEYHNTGDAPFFVSWDFILRKVPHSEFGLSSQSTTSSVPGTPISEINP
FKKIGSISDMAFANKGSDEATRKGVLIPVHYLDEAEEVLYKALSVFPRSTPAAAKPKKSG
TLPDRSRPAPRSESDEELSGVCNVAIRDVEDLDDSELSSRLTALVNDAKSELLARGIRRL
TFVCGHEDGTYPGYFTFRGPTYAEDVSIRHSEPALAFQLELGRLSKFKIKPVFTENRNLH
VYEAIGKGPELNDNAVDKRYFTRAVVRPGRLRDDIPTAEYLISEADNLMTDILDALEIIG
NNNSDLNHIFINFTPVFPLQPVDVEKALAGFLERFGRRLWRLRVTGAEIRILCTDPATGT
PYPLRVVITNTSGYIIQVELYVERKSEKGEWIFHSIGGTTKIGSMHLRPVSTPYPTKEWL
QPKRYKAHLMGTQYVYDFPELFRQAFQNSWTTAIAAHPALAEKRPALGTCIEYSELVLDD
RDNLAEVSREPGTNTHGMVGWLITAKTPEYPRGRRFIVVANDITYQIGSFGPQEDKFFYQ
CTELARKLGIPRIYLSANSGARIGMADELMSQFNVAWNNPDKPENGFKYLYLTPEVEKRL
EKEKKKDLITELITEDGEERYKITTIIGAKDGLGVECLRGSGLIAGATSKAYEDIFTITL
VTCRSVGIGAYLVRLGHRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNG
VSHMTANDDFAGITKIVEWMSFVPEKKGAPIPIRPSSDPWNRDITYCPPPRQPYDVRWII
GGKEDDEGFLSGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVDCVTPADP
ANPDSMEVLSTEAGGVWYPNSAFKTAQALKDFNNGEQLPVMILANWRGFSGGQRDMYNEV
LKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVIDPTINPDQMEMYADVEARGGILEP
EGIVNIKYRRDKQLDTMARLDPEYGALRESLKDKSHSPEKLSEIKAQMTEREERLLPVYM
QIALQFADLHDRAGRMEAKGTIRQPLEWKNARRFFYWRLRRRLSEEIILKRMAAATVSSA
TSSQASSSPPSSPIPTHSDAPSRINTSTITTPRTQRDENLDKLKAWTGISDDEFESNDRE
VAIWYEENKKNVYEKIEALKTDGIAAEVASLLMGNKEGGLRGVQKVLSMLPDNEKAAVLK
YLGSS
NT seq 6498 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaggggacatgcgtctgaaaaccccaagctccctgaatccctcgccgcttca
cccaaaaagatcatcttcattggcccccctggtaacgcaatgcgctctctcggagataag
atctcttctacgatagttgctcagcacgcgggggttccctgcattccgtggtcgggcacg
ggcgtagatgaggttaaaatcgatgaggagggcatcgttactgtggaggacaatgtttat
gatcaaggatgcacccactctcctgaggacggtctcaagaaggctcgagagattggcttc
ccagttatggttaaagcctccgagggtggtggtggtaagggtatccgcaaggtcgacagt
gaggagaactttgaggccctctacaatgccgctgctagcgaaattcctgggtctcctatc
ttcatcatgaagcttgctggaaatgctagacatctggaagtccagcttctcgctgatcag
tacggcaacaacatctctctctttggccgtgactgttccgtccagcgaagacaccagaaa
attatcgaggaagctcctgttaccgttgctaagcagactaccttccaggagatggagaag
gccgcagttcgtctcggtcgtctcgttggttacgtctctgctggtaccgtggaatatctc
tattcccatgccgatgacaagttttacttccttgagctcaaccctcgtttgcaagtcgag
catcctaccactgagatggtcactggcgtcaacctcccagccgctcagctgcagattgcc
atgggtctccctcttcaccgcatccgtgacattcgtctcctttacggcgtggatcccaac
acctcctctcctatcgacttcggcttctcaaacgaggagagcactatggtccagcgtcgt
cctcaaccaaagggccacactactgcttgtcgaatcacctccgaagatccaggtgaaggt
ttcaaaccctctagcggtactatgcacgagctgaacttccgaagttcctccaacgtttgg
ggttacttctctgtgggcaccgcgggcggtatccacagcttctctgattcccagtttggt
cacatcttcgcctacggagagaaccgctctgcttccagaaaacacatggttgttgcactc
aaggaactgagcatccgtggtgactttaggaccactgttgagtacctcattaaacttctt
gaaactcctgctttcgaggataacaccatcactactggatggctggatgagcttatcacc
aagaagctcactgctgagcggcctgatcccatggttgccgtaatctgcggtgccatgacc
aaggctcatcttgccagtgaagcctgcgagtctgaataccgcaagggtattgaaaagggt
caggtgcctgccaaagacgttctgagcaccgtgttcccaattgacttcatctatgaaggt
tcgcgctacaagtttacggccacccgctccagcatagacagctaccacctctatatcaat
ggcagcaagtgtacagttggtgttcgggctctggctgacggtggtcttcttattcttctt
gacggacgaagccacaatgtttactggaaggaagaagctgcggccacccgtctatctgtt
gatgggaagacctgtctccttgagcaagaaaatgaccctacgcagctccgaacacctagt
cctggtaagctggttaagttcactgtcgagaacggtgagcatatccgtgctggcgaggct
ttcgccgaagtcgagatcatgaagatgtacatgcctttgatcgcccaggaggatggtgtc
gtccaattcatcaagcagcccggagccacccttgaagctggtgatattctcggtatcctt
gcgcttgacgacccatcccgagttaagcatgcctctccattcacgggtcagctacctgag
cttggtccaccacaggtactcggtaacaagcctccacagcgcttcatggttctcctcaag
attctccaggacatccttctcggatacgataaccaggttatcatggggagcaccttgaac
gaacttgttcaggtcttgcgtaaccctgaacttccctatggtgaatggaacgcttatgcc
tctgctttgcactctcgtatgccccagaaacttgatgctcaaatgactcaggtcattgac
cgtgcaaaggctcgcaaggcagatttcccagctgcccagcttctcaagactgtcacccgt
ttcatcgatgagaatgtcaaagcagcagctgatgccgaagctctgcgaaccaccattgct
ccgcttcttcagatcatcgagcgatacaaggacggactcaaggtccaggagtacaagatc
attgtctccctcctcgagcaatactgggaagttgagcgtctgttcgctcagggaaacacc
cgtgatgagagtgtcatcttgaaactccgtgatgagaacaaggatgatatctccaaggta
atccagatcgtcctctcgcatagcaagataggatccaagaacaacctcattctcgcaatc
cttgacatgtaccgccctaacaagcctaatgtcggcaatgttgcaaactacctcaaggct
atccttcgtaagttggctgagcttgagtctcgcgctactgccaaggttgctctcaaggct
cgtgaggtgcttattcagtgtgccctgccatctcttgaggagcgagttgctcagatggag
cacatcttgcgatcatccgtgatcgaatccaaatatggtgagaccggctgggatcacaga
gaacctgacctcaatgttctcaaggaagtcgtggattccaagtataccgtctttgacgtt
ctgcctctcttcttcgcccacaatgatcaatgggtatccctcgctgcattggaagtctat
gtccgccgtgcctatcgtgcctatgctttgaagggtattgaatatcacaatactggtgat
gcaccattttttgtctcctgggatttcatcctgcgcaaggttcctcactctgaatttggg
ttgtcttctcaatcaaccacctcgtctgttccaggaacaccgatttcagagattaacccc
tttaagaaaatcggatcaatcagcgacatggccttcgccaacaaaggatctgacgaggcg
actagaaagggtgtcttgattccagttcactatctcgatgaggcagaggaagttctatac
aaagctctcagtgtcttcccgcgttccactcccgccgcagccaagccaaagaagagcggt
accttgcctgaccgtagcagacctgcgccacgctctgaatccgatgaagaactctccggt
gtttgcaacgtggctatacgtgacgttgaagatttggatgactctgagctgtcttcgcgt
ctcactgctcttgttaacgatgcaaagagtgaattgcttgctcgtggaatccgccgactc
acttttgtttgcggtcatgaggacggtacttaccctggttacttcactttccgtggtcct
acttatgccgaagacgtgagtatccgtcacagcgagccagcacttgctttccagcttgaa
cttggccgtctatccaaattcaagatcaagcctgtcttcaccgaaaatcgtaacttgcac
gtttatgaggctatcggcaagggaccagaactcaatgacaatgccgttgacaagcgctac
ttcactcgtgccgtcgtccgccctggcaggctacgtgatgacattcccaccgcggaatat
ctcatttctgaagccgacaacttgatgacagatattcttgacgcccttgagatcattggc
aacaataactctgatctcaaccatatctttatcaatttcactcccgtcttccccttgcaa
ccagttgatgttgagaaagccctcgctggtttccttgaacgtttcggtcgtcgtctctgg
cgtctacgtgtcactggtgccgaaatccgtatcctttgcaccgacccagctaccggcaca
ccttacccgctccgagttgtcatcaccaacacttcaggctatatcatccaggttgaactt
tacgtggagcgtaagtctgaaaaaggcgaatggattttccattcaatcggcggcactacc
aagattggatccatgcacttacgtcctgtctctaccccttatcctaccaaagagtggctg
cagcccaagcgttacaaggcccatctgatgggtactcaatacgtgtacgatttcccagag
ctgttccgtcaggctttccagaacagctggactactgctattgctgcccatcccgctttg
gctgagaagagacctgcgcttggaacctgcatcgaatattctgaactcgttcttgatgac
agggacaacctcgctgaagtttctcgtgaaccaggcactaacacccacggaatggtcggc
tggttgatcactgctaagaccccagaatatcctcgtggacgacgctttattgtcgttgcc
aacgatatcacttaccagataggctctttcggaccacaagaggataaatttttctaccaa
tgtacagaattggccagaaagctgggcattcctagaatctatctttctgctaactctggt
gcacgtatcggcatggctgatgaactcatgtctcagttcaatgttgcttggaacaacccc
gacaaaccagagaacggattcaagtatctctacctcaccccagaggttgagaagcgtctc
gagaaggaaaagaagaaggatctgatcactgagttgattaccgaggatggtgaagagcgc
tacaagatcaccactatcattggagctaaggacggccttggtgttgaatgtctccgaggt
tcggggttgattgccggtgccacatccaaggcatacgaggacatctttactatcactctt
gttacctgtcgttccgttggaatcggtgcatacctcgttcgcctaggtcatcgtgccatc
caggttgagggtcaacccatcatccttactggtgcgccagctataaacaagctccttggc
cgtgaagtatatacctccaacttgcaactcggcggtacccaaatcatgtacaagaacggt
gtctcgcacatgactgctaacgatgactttgctggtatcaccaaaattgtggagtggatg
tccttcgtccctgagaagaagggcgctccaatccccatccgcccttcctctgacccctgg
aaccgagacattacttattgccctccacccaggcagccctatgatgtccgttggatcatt
gggggtaaggaagatgatgaaggattcttgtctggtctattcgacaagggctccttcgaa
gaagctctcggtggctgggctagaaccgtcgttgtcggccgtgctagactcggtggtatc
cctatgggtgttattgctgtcgaaactcgatcggtcgactgtgtcacccctgccgacccc
gccaaccctgattctatggaagttctgtccacagaagctggaggggtctggtaccctaac
tctgcattcaagactgcgcaagccctcaaggactttaacaacggtgagcagctacctgtc
atgatcctcgctaactggcgtggtttctccggtggccaacgtgacatgtacaacgaggtt
cttaaatacggttcctacatcgttgatgcccttgttaagtacgagcagccaatcttcgtc
tatattccaccacacggtgaactccgtggtggttcttgggtcgttattgacccaactatc
aaccccgatcagatggagatgtatgccgacgttgaggcccgtggtggtattctcgagcct
gaaggtatcgtcaacatcaaataccgccgggataagcagcttgatactatggcccgcctg
gatcccgaatatggtgctctccgtgaatctctcaaggacaagtctcatagcccagagaag
ctttctgaaatcaaggcccagatgaccgagcgtgaagagaggctcctccctgtctacatg
cagattgccctgcaattcgctgaccttcatgaccgcgccggccgtatggaagccaagggt
actatccgacaaccgctcgaatggaagaacgcacgtcgcttcttctactggcgtctccgc
cgtcgtctaagtgaagaaattattcttaagcgcatggccgctgcgactgtttcttccgcc
actagctctcaagcctcatcctcccctccctcatctcccatcccaactcactccgacgct
ccatcccgaatcaatacgtcaaccatcaccaccccgcgcacccagcgtgacgagaacctt
gacaaactcaaggcctggactggaatctctgacgatgaattcgagtctaacgaccgtgag
gtcgcgatttggtacgaagaaaacaagaagaacgtctacgagaagatcgaggctctcaag
accgacggaattgctgcagaggttgcgtctttgctcatgggcaacaaagaaggtggtcta
cggggtgtacaaaaagtcctcagcatgcttcctgacaatgagaaggctgctgtactgaaa
tacttgggctcatcttaa

DBGET integrated database retrieval system