KEGG   Trichophyton verrucosum: TRV_07116Help
Entry
TRV_07116         CDS       T01615                                 

Definition
pyruvate carboxylase, putative
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tve  Trichophyton verrucosum
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tve01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tve00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tve00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:tve00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2165 aa AA seqDB search
MAGRGHASENPKLPESLAASPKKIIFIGPPGNAMRSLGDKISSTIVAQHAGVPCIPWSGT
GVDEVKIDEEGIVTVEDNVYDQGCTHSPEDGLKKAREIGFPVMVKASEGGGGKGIRKVDS
EENFEALYNAAASEIPGSPIFIMKLAGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQK
IIEEAPVTVAKQTTFQEMEKAAVRLGRLVGYVSAGTVEYLYSHADDKFYFLELNPRLQVE
HPTTEMVTGVNLPAAQLQIAMGLPLHRIRDIRLLYGVDPNTSSPIDFGFSNEESTMVQRR
PQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFG
HIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLLETPAFEDNTITTGWLDELIT
KKLTAERPDPMVAVICGAMTKAHLASEACESEYRKGIEKGQVPAKDVLSTVFPIDFIYEG
SRYKFTATRSSIDSYHLYINGSKCTVGVRALADGGLLILLDGRSHNVYWKEEAAATRLSV
DGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHIRAGEAFAEVEIMKMYMPLIAQEDGV
VQFIKQPGATLEAGDILGILALDDPSRVKHASPFTGQLPELGPPQVLGNKPPQRFMVLLK
ILQDILLGYDNQVIMGSTLNELVQVLRNPELPYGEWNAYASALHSRMPQKLDAQMTQVID
RAKARKADFPAAQLLKTVTRFIDENVKAAADAEALRTTIAPLLQIIERYKDGLKVQEYKI
IVSLLEQYWEVERLFAQGNTRDESVILKLRDENKDDISKVIQIVLSHSKIGSKNNLILAI
LDMYRPNKPNVGNVANYLKAILRKLAELESRATAKVALKAREVLIQCALPSLEERVAQME
HILRSSVIESKYGETGWDHREPDLNVLKEVVDSKYTVFDVLPLFFAHNDQWVSLAALEVY
VRRAYRAYALKGIEYHNTGDAPFFVSWDFILRKVPHSEFGLSSQSTTSSVPGTPISEINP
FKKIGSISDMAFANKGSDEATRKGVLIPVHYLDEAEEVLYKALSVFPRSTPAAAKPKKSG
TLPDRSRPAPRSESDEELSGVCNVAIRDVEDLDDSELSSRLTALVNDAKSELLARGIRRL
TFVCGHEDGTYPGYFTFRGPTYAEDVSIRHSEPALAFQLELGRLSKFKIKPVFTENRNLH
VYEAIGKGPELNDNAVDKRYFTRAVVRPGRLRDDIPTAEYLISEADNLMTDILDALEIIG
NNNSDLNHIFINFTPVFPLQPVDVEKALAGFLERFGRRLWRLRVTGAEIRILCTDPATGT
PYPLRVVITNTSGYIIQVELYVERKSEKGEWIFHSIGGTTKIGSMHLRPVSTPYPTKEWL
QPKRYKAHLMGTQYVYDFPELFRQAFQNSWTTAIAAHPALAEKRPALGTCIEYSELVLDD
RDNLAEVSREPGTNTHGMVGWLITAKTPEYPRGRRFIVVANDITYQIGSFGPQEDKFFYQ
CTELARKLGIPRIYLSANSGARIGMADELMSQFNVAWNNPDKPENGFKYLYLTPEVEKRL
EKEKKKDLITELITEDGEERYKITTIIGAKDGLGVECLRGSGLIAGATSKAYEDIFTITL
VTCRSVGIGAYLVRLGHRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNG
VSHMTANDDFAGITKIVEWMSFVPEKKGAPIPIRPSSDPWNRDITYCPPPRQPYDVRWII
GGKEDDEGFLSGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVDCVTPADP
ANPDSMEVLSTEAGGVWYPNSAFKTAQALKDFNNGEQLPVMILANWRGFSGGQRDMYNEV
LKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVIDPTINPDQMEMYADVEARGGILEP
EGIVNIKYRRDKQLDTMARLDPEYGALRESLKDKSHSPEKLSEIKAQMTEREERLLPVYM
QIALQFADLHDRAGRMEAKGTIRQPLEWKNARRFFYWRLRRRLSEEIILKRMAAATVSSA
TSSQASSSPPSSPIPTHSDAPSRINTSTITTPRTQRDENLDKLKAWTGISDDEFESNDRE
VAIWYEENKKNVYEKIEALKTDGIAAEVASLLMGNKEGGLRGVQKVLSMLPDNEKAAVLK
YLGSS
NT seq 6498 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaggggacatgcgtctgaaaaccccaagctccctgaatccctcgccgcttca
cccaaaaagatcatcttcattggcccccctggtaacgcaatgcgctctctcggagataag
atctcttctacgatagttgctcagcacgcgggggttccctgcattccgtggtcgggcacg
ggcgtagatgaggttaaaatcgatgaggagggcatcgttactgtggaggacaatgtttat
gatcaaggatgcacccactctcctgaggacggtctcaagaaggctcgagagattggcttc
ccagttatggttaaagcctccgagggtggtggtggtaagggtatccgcaaggtcgacagt
gaggagaactttgaggccctctacaatgccgctgctagcgaaattcctgggtctcctatc
ttcatcatgaagcttgctggaaatgctagacatctggaagtccagcttctcgctgatcag
tacggcaacaacatctctctctttggccgtgactgttccgtccagcgaagacaccagaaa
attatcgaggaagctcctgttaccgttgctaagcagactaccttccaggagatggagaag
gccgcagttcgtctcggtcgtctcgttggttacgtctctgctggtaccgtggaatatctc
tattcccatgccgatgacaagttttacttccttgagctcaaccctcgtttgcaagtcgag
catcctaccactgagatggtcactggcgtcaacctcccagccgctcagctgcagattgcc
atgggtctccctcttcaccgcatccgtgacattcgtctcctttacggcgtggatcccaac
acctcctctcctatcgacttcggcttctcaaacgaggagagcactatggtccagcgtcgt
cctcaaccaaagggccacactactgcttgtcgaatcacctccgaagatccaggtgaaggt
ttcaaaccctctagcggtactatgcacgagctgaacttccgaagttcctccaacgtttgg
ggttacttctctgtgggcaccgcgggcggtatccacagcttctctgattcccagtttggt
cacatcttcgcctacggagagaaccgctctgcttccagaaaacacatggttgttgcactc
aaggaactgagcatccgtggtgactttaggaccactgttgagtacctcattaaacttctt
gaaactcctgctttcgaggataacaccatcactactggatggctggatgagcttatcacc
aagaagctcactgctgagcggcctgatcccatggttgccgtaatctgcggtgccatgacc
aaggctcatcttgccagtgaagcctgcgagtctgaataccgcaagggtattgaaaagggt
caggtgcctgccaaagacgttctgagcaccgtgttcccaattgacttcatctatgaaggt
tcgcgctacaagtttacggccacccgctccagcatagacagctaccacctctatatcaat
ggcagcaagtgtacagttggtgttcgggctctggctgacggtggtcttcttattcttctt
gacggacgaagccacaatgtttactggaaggaagaagctgcggccacccgtctatctgtt
gatgggaagacctgtctccttgagcaagaaaatgaccctacgcagctccgaacacctagt
cctggtaagctggttaagttcactgtcgagaacggtgagcatatccgtgctggcgaggct
ttcgccgaagtcgagatcatgaagatgtacatgcctttgatcgcccaggaggatggtgtc
gtccaattcatcaagcagcccggagccacccttgaagctggtgatattctcggtatcctt
gcgcttgacgacccatcccgagttaagcatgcctctccattcacgggtcagctacctgag
cttggtccaccacaggtactcggtaacaagcctccacagcgcttcatggttctcctcaag
attctccaggacatccttctcggatacgataaccaggttatcatggggagcaccttgaac
gaacttgttcaggtcttgcgtaaccctgaacttccctatggtgaatggaacgcttatgcc
tctgctttgcactctcgtatgccccagaaacttgatgctcaaatgactcaggtcattgac
cgtgcaaaggctcgcaaggcagatttcccagctgcccagcttctcaagactgtcacccgt
ttcatcgatgagaatgtcaaagcagcagctgatgccgaagctctgcgaaccaccattgct
ccgcttcttcagatcatcgagcgatacaaggacggactcaaggtccaggagtacaagatc
attgtctccctcctcgagcaatactgggaagttgagcgtctgttcgctcagggaaacacc
cgtgatgagagtgtcatcttgaaactccgtgatgagaacaaggatgatatctccaaggta
atccagatcgtcctctcgcatagcaagataggatccaagaacaacctcattctcgcaatc
cttgacatgtaccgccctaacaagcctaatgtcggcaatgttgcaaactacctcaaggct
atccttcgtaagttggctgagcttgagtctcgcgctactgccaaggttgctctcaaggct
cgtgaggtgcttattcagtgtgccctgccatctcttgaggagcgagttgctcagatggag
cacatcttgcgatcatccgtgatcgaatccaaatatggtgagaccggctgggatcacaga
gaacctgacctcaatgttctcaaggaagtcgtggattccaagtataccgtctttgacgtt
ctgcctctcttcttcgcccacaatgatcaatgggtatccctcgctgcattggaagtctat
gtccgccgtgcctatcgtgcctatgctttgaagggtattgaatatcacaatactggtgat
gcaccattttttgtctcctgggatttcatcctgcgcaaggttcctcactctgaatttggg
ttgtcttctcaatcaaccacctcgtctgttccaggaacaccgatttcagagattaacccc
tttaagaaaatcggatcaatcagcgacatggccttcgccaacaaaggatctgacgaggcg
actagaaagggtgtcttgattccagttcactatctcgatgaggcagaggaagttctatac
aaagctctcagtgtcttcccgcgttccactcccgccgcagccaagccaaagaagagcggt
accttgcctgaccgtagcagacctgcgccacgctctgaatccgatgaagaactctccggt
gtttgcaacgtggctatacgtgacgttgaagatttggatgactctgagctgtcttcgcgt
ctcactgctcttgttaacgatgcaaagagtgaattgcttgctcgtggaatccgccgactc
acttttgtttgcggtcatgaggacggtacttaccctggttacttcactttccgtggtcct
acttatgccgaagacgtgagtatccgtcacagcgagccagcacttgctttccagcttgaa
cttggccgtctatccaaattcaagatcaagcctgtcttcaccgaaaatcgtaacttgcac
gtttatgaggctatcggcaagggaccagaactcaatgacaatgccgttgacaagcgctac
ttcactcgtgccgtcgtccgccctggcaggctacgtgatgacattcccaccgcggaatat
ctcatttctgaagccgacaacttgatgacagatattcttgacgcccttgagatcattggc
aacaataactctgatctcaaccatatctttatcaatttcactcccgtcttccccttgcaa
ccagttgatgttgagaaagccctcgctggtttccttgaacgtttcggtcgtcgtctctgg
cgtctacgtgtcactggtgccgaaatccgtatcctttgcaccgacccagctaccggcaca
ccttacccgctccgagttgtcatcaccaacacttcaggctatatcatccaggttgaactt
tacgtggagcgtaagtctgaaaaaggcgaatggattttccattcaatcggcggcactacc
aagattggatccatgcacttacgtcctgtctctaccccttatcctaccaaagagtggctg
cagcccaagcgttacaaggcccatctgatgggtactcaatacgtgtacgatttcccagag
ctgttccgtcaggctttccagaacagctggactactgctattgctgcccatcccgctttg
gctgagaagagacctgcgcttggaacctgcatcgaatattctgaactcgttcttgatgac
agggacaacctcgctgaagtttctcgtgaaccaggcactaacacccacggaatggtcggc
tggttgatcactgctaagaccccagaatatcctcgtggacgacgctttattgtcgttgcc
aacgatatcacttaccagataggctctttcggaccacaagaggataaatttttctaccaa
tgtacagaattggccagaaagctgggcattcctagaatctatctttctgctaactctggt
gcacgtatcggcatggctgatgaactcatgtctcagttcaatgttgcttggaacaacccc
gacaaaccagagaacggattcaagtatctctacctcaccccagaggttgagaagcgtctc
gagaaggaaaagaagaaggatctgatcactgagttgattaccgaggatggtgaagagcgc
tacaagatcaccactatcattggagctaaggacggccttggtgttgaatgtctccgaggt
tcggggttgattgccggtgccacatccaaggcatacgaggacatctttactatcactctt
gttacctgtcgttccgttggaatcggtgcatacctcgttcgcctaggtcatcgtgccatc
caggttgagggtcaacccatcatccttactggtgcgccagctataaacaagctccttggc
cgtgaagtatatacctccaacttgcaactcggcggtacccaaatcatgtacaagaacggt
gtctcgcacatgactgctaacgatgactttgctggtatcaccaaaattgtggagtggatg
tccttcgtccctgagaagaagggcgctccaatccccatccgcccttcctctgacccctgg
aaccgagacattacttattgccctccacccaggcagccctatgatgtccgttggatcatt
gggggtaaggaagatgatgaaggattcttgtctggtctattcgacaagggctccttcgaa
gaagctctcggtggctgggctagaaccgtcgttgtcggccgtgctagactcggtggtatc
cctatgggtgttattgctgtcgaaactcgatcggtcgactgtgtcacccctgccgacccc
gccaaccctgattctatggaagttctgtccacagaagctggaggggtctggtaccctaac
tctgcattcaagactgcgcaagccctcaaggactttaacaacggtgagcagctacctgtc
atgatcctcgctaactggcgtggtttctccggtggccaacgtgacatgtacaacgaggtt
cttaaatacggttcctacatcgttgatgcccttgttaagtacgagcagccaatcttcgtc
tatattccaccacacggtgaactccgtggtggttcttgggtcgttattgacccaactatc
aaccccgatcagatggagatgtatgccgacgttgaggcccgtggtggtattctcgagcct
gaaggtatcgtcaacatcaaataccgccgggataagcagcttgatactatggcccgcctg
gatcccgaatatggtgctctccgtgaatctctcaaggacaagtctcatagcccagagaag
ctttctgaaatcaaggcccagatgaccgagcgtgaagagaggctcctccctgtctacatg
cagattgccctgcaattcgctgaccttcatgaccgcgccggccgtatggaagccaagggt
actatccgacaaccgctcgaatggaagaacgcacgtcgcttcttctactggcgtctccgc
cgtcgtctaagtgaagaaattattcttaagcgcatggccgctgcgactgtttcttccgcc
actagctctcaagcctcatcctcccctccctcatctcccatcccaactcactccgacgct
ccatcccgaatcaatacgtcaaccatcaccaccccgcgcacccagcgtgacgagaacctt
gacaaactcaaggcctggactggaatctctgacgatgaattcgagtctaacgaccgtgag
gtcgcgatttggtacgaagaaaacaagaagaacgtctacgagaagatcgaggctctcaag
accgacggaattgctgcagaggttgcgtctttgctcatgggcaacaaagaaggtggtcta
cggggtgtacaaaaagtcctcagcatgcttcctgacaatgagaaggctgctgtactgaaa
tacttgggctcatcttaa

DBGET integrated database retrieval system