KEGG   Trichophyton verrucosum: TRV_07203Help
Entry
TRV_07203         CDS       T01615                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TRV_07203
    1.3.1.94  polyprenol reductase
     TRV_07203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MDGLAGMDLVDWIRGGYVVLAASVMAVNSLKFLRDRFISYGARTLPASKEPSSKPSAVAT
VPPWGGIAGILDRVATWDVPHSYFTHFYYCAVGVAFFWWYQLLARGWAFKLIASMVDHET
RKSSMSFNQIFLCWSLFTIQACRRLYECLSFVKPSQARMHVGHWLYGFAYYIVMGVAIWI
EGTSRIFSTFLYLIERGSNLKLKATLLSTNSPLGNAALTAPSLRSLIFIPVFIFASGIQY
DCHEYLASLVKYTLPVHPAFVNIISPHYTAECMIYLSLSFLAAPPGSIVNNTIFSAVILT
AVQLGTSAAATKKWYSEKFGREKVKDRWIMLPFIW
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatgggctcgctggcatggaccttgtcgactggataagaggcggatatgtggtgcta
gctgccagtgtcatggctgtcaacagtctcaagttccttcgtgacaggttcatttcatat
ggtgcccggactctgccagcatcgaaggagccgagtagcaaaccttcggcagtggccact
gtccctccatggggtggcattgcaggaatcctggaccgcgtggcaacctgggatgtgccg
cattcctacttcactcatttctactactgcgccgtcggcgtggcgttcttctggtggtat
cagcttctggccagaggatgggcctttaagctcattgccagcatggtagatcatgaaacc
cgaaagagttcaatgtcctttaaccagatattcctttgctggtcacttttcaccatccag
gcctgccgtcgactctacgagtgcctctcatttgttaagccctctcaggcaaggatgcac
gtcgggcattggctctacgggtttgcctattacatcgtcatgggagttgctatctggatt
gaaggaaccagtaggattttttctacctttttatatttgattgaacgcggatctaacttg
aaacttaaagcaactctactctcaactaatagtccattgggcaatgctgctctgacggcg
ccttccctgaggtcgttgatctttatcccagtgttcatatttgcttctggaatacagtat
gactgccacgagtatctggcatcccttgttaaatataccctcccggtgcatcccgcgttc
gtcaacataatatctccacactacacagcggaatgcatgatatacctttcgttaagcttc
cttgctgcacccccaggatcgattgtcaacaataccatcttctccgctgtgattctcact
gcagtgcagctgggtacttcagcagcagctacgaagaagtggtatagcgagaagttcggg
agggaaaaggttaaggacagatggatcatgctaccctttatatggtag

DBGET integrated database retrieval system