KEGG   Trichophyton verrucosum: TRV_07242Help
Entry
TRV_07242         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRV_07242
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TRV_07242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 282 aa AA seqDB search
MSSLKNCPVYGVIFLFKWVSGQSRNTSNPQDGKYDHGAVEDGLFFAAQTIQNACGTQAVL
SVILNQDSPSTSTRGIDIGSELRSFKEFTTGFPPDLRGETLSNSARIRSAHNLFARSSPF
VDETSRPPPSEEDAELYHFIAYLPFGGKLYELDGLQPHPITHGPCSSEEFPEKVIDVLHR
RIGRYPEGEIRFNLMAVVRDLRIRAQEIGDEEMLDREKRKRENWAWENSLRKCNFIDFTG
QLLKGVVGMKLKQGTEEYDKWIEDAKKATSKRTESKRSNRLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtttgaagaattgtcccgtatacggcgttatatttttattcaaatgggttagt
ggacagtcgagaaacacgtccaatcctcaagacgggaaatacgatcatggagcggttgaa
gatggccttttctttgctgcccagacgatacagaatgcttgtggtacacaagcggtccta
tctgtgatactcaaccaagacagcccatcaacatccaccaggggaatcgacattggctcc
gagctacgttctttcaaggagtttactaccggattccctcctgacctcaggggcgaaacg
ttgagcaattcagcccggatccgcagcgcccataatctgttcgctcgctcgtctcctttt
gtagacgaaacctcgcgcccacctccatcagaagaagatgcagaactataccatttcatc
gcctaccttccctttggcggcaagttgtacgagttggacgggttacaaccacatccaata
actcatggaccctgcagttcagaagaattcccggagaaggttattgatgttcttcatcga
cgaattgggcggtaccccgaaggagagattcgattcaatctcatggctgttgtgagggac
ttgaggatacgtgcacaagagattggggatgaagagatgctggatagagagaagagaaag
agagaaaattgggcttgggaaaactcgctgagaaagtgtaactttattgactttacagga
cagcttttgaagggggttgtgggcatgaagttaaagcaaggtacggaggaatatgacaag
tggatagaagatgcaaagaaagcaactagcaaacggacagaatccaaacgctcaaaccgg
cttggatag

DBGET integrated database retrieval system