KEGG   Trichophyton verrucosum: TRV_07366Help
Entry
TRV_07366         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tve  Trichophyton verrucosum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tve04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 581 aa AA seqDB search
MQELSSFIEEKLEMIKPGSRPPGGVNLPKPGDKEGQMILPDKDKADGNSEPEKPTKGNSK
VPSKGSDDSKGSKDTKTSKDPKDSKNRKGDKSPVQVPAPKKEVKEKKYNLSGSSVSLTAE
SFLKLVTTTQDPWFIKFYAPWCSHCQALAPVWQQMAKDMNGKLNVGEVNCEAERRLCKEA
RISSYPTMHFFRGGEKVQYEGLRGLGDLVNYANKATDVVGLGVQYVDAEAFKKMEETEEV
IFLYFFDHATTSEDFAALDRLTLSLVGRARLVKTDSKELAERFRISTWPRLLVARDGTAK
YYTALAPRDMRDFRAVLSWMQSVWLPIVPELTATNARDVMDGKYVVLGILNRQHNEDFVQ
NKRELKNAALEWMEKQTKLFQLERQELRDAKDLRIEEADDRNDQRALRAAKSMRITIRED
DKKQVGFAWVDGIFWDRWVKTTFGVDVKNGDRIIIHDESNRRYWDSSPNGVDIMPSRTSI
LETLTHIAASSPKLKSKSTVGFFEHIFFTTRTFVSSHPFITLALCIVTIAIASLWAKRQI
RRTRTVTGKLGGSSMGFFHLDGKEKGLFSSVGSGPSNGKVD
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacttagcagtttcattgaagaaaaactagaaatgatcaaaccaggttctaga
cctcctggaggggtaaacctccccaagccgggcgataaggagggacagatgatcctaccg
gataaagacaaggcagatgggaactctgaacccgaaaagccaactaagggcaatagcaag
gtcccttcaaagggatcagatgattcgaagggctcaaaagacaccaagacctccaaagat
cctaaggactccaagaatcgaaagggcgataagagtcctgttcaagtccctgcccccaag
aaggaagtcaaggagaagaagtataatctctcaggatcatctgtttctttgactgcagaa
tcattcctgaaacttgtcactaccactcaagatccatggtttatcaagttctatgcccct
tggtgtagccactgccaggcacttgctcctgtgtggcagcaaatggctaaggacatgaat
gggaagctaaacgttggcgaggttaattgtgaagcggaacgacgtctatgcaaagaagca
cgaatttcctcatacccgacaatgcatttcttccgtggaggtgagaaagtccaatatgaa
ggcctacgcgggctgggtgacctggttaattacgccaacaaggcaaccgatgtagtgggc
ctcggtgtccaatacgtcgacgcagaagctttcaagaagatggaggaaactgaggaggtc
atcttcctctatttcttcgaccatgccacaacttctgaagactttgctgctcttgataga
ctcaccctcagcttagtaggacgtgcccgactagtgaagactgatagcaaggagcttgct
gagcgattcagaatctctacatggccccgtctcctcgtggccagggatggaaccgccaaa
tattataccgctttggccccaagagatatgagagacttccgcgctgttctgtcttggatg
cagagtgtttggctccctatcgtgccagaattgacagctaccaatgcccgcgatgtcatg
gatggtaaatatgttgttctcggaatcctcaacagacagcataacgaagacttcgtccaa
aacaaacgtgagctcaagaacgcagcattggaatggatggaaaaacagaccaagctattc
cagctagagcgtcaggaactacgagatgctaaagacctccggattgaagaagccgatgat
cgtaatgaccagcgcgccctgcgagctgccaagagcatgcgcatcacaatccgtgaggat
gataagaaacaggtcgggttcgcttgggttgatggaattttctgggaccgatgggtcaaa
actacctttggcgtcgatgtgaagaacggagacagaattattatccacgacgaatcgaac
cgtcgctactgggactcgtctccaaacggtgttgatatcatgcccagccgtacttctatc
ctcgaaacactcactcacattgccgcttcttctccgaagctcaagtccaagtccactgtt
ggcttctttgagcacatctttttcactactcgtacctttgtcagctcacatcctttcatc
actcttgcattgtgcattgtcaccattgccatcgcttctctgtgggctaagcgtcaaatc
cgccgaacaagaaccgtgaccggaaaactcggaggctcttccatgggtttcttccaccta
gatggaaaggagaaagggctctttagctccgttgggtctggtccaagtaacggaaaagtc
gattaa

DBGET integrated database retrieval system