KEGG   Trichophyton verrucosum: TRV_07489Help
Entry
TRV_07489         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 500 aa AA seqDB search
MFYNDPNVLYISIHVYRDGSFYPGGDEGNWDYCGEGLGLGKNVNIPWPTQGMGDGDYLYA
FQEVVMPIGYEFDPDLVIISAGFDAAAGDELGGCFVTPPCYSHMTRMLMNLANGKVAVCL
EGGYNFRSISKSALAVTRTLMGEPPDRLIAPSASRPAVETARRRTLPATVYMVCMVITGE
EGGMLIGVGVGTDIIRQYQAKQLYEEHKLTSLYIYRDTISKSFENQVLASQNYDKVDTLL
VIFHDPPELMGIPHPVTNVLEAHNTWLQVQKEEWLTEGTNKADNVKDYISWAVEHNVGVI
DVNIPKHISEADQNSRSYERESPNRALFSEQLAEYLWENYIECVYPTDLSLLAAVVGCLL
LTTRRTNDTSRIFFMGVGDAFLGLANLLINKERVHTMVSGVICFVAENPVRAVASTTITW
LSKWYKEYRRSNKMKNSLVFVSHRHMVWEGQENKQKQYKRYGRLVKSTAAHTLNEMLVNH
RADVFKWIEERVEAGSESSS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttctacaatgacccgaacgtactatacatctcgatccatgtctaccgggatggcagc
ttctatcccggcggtgacgaaggcaactgggactactgcggtgaaggtctcggtctaggg
aagaacgtcaacattccctggccgacacaaggcatgggagacggcgactacctctatgcc
ttccaggaagttgttatgccaatcggctacgagtttgatcctgacctcgtcatcatatcc
gccggcttcgatgcggcggcgggcgacgagctgggaggctgtttcgtgacacccccttgc
tactcacacatgacgcgcatgctgatgaaccttgccaacggaaaggtagcggtgtgtctt
gagggagggtataacttccgctcgatctccaagtcagcgctagcggttacgcggacattg
atgggcgagccgcccgatcggctgattgcgccgtcagcgtcgcggccggccgttgagacg
gcccgtcgtcgaactttgccggcaaccgtgtacatggtatgtatggtgataacaggagaa
gagggaggaatgctaattggtgttggggtgggaacagatatcatccggcagtaccaggcg
aagcagctgtatgaggagcacaagctgacgagcctgtacatctaccgggacacgatctcg
aagtcgtttgagaaccaggtgctggcgagccagaactacgacaaggtggacactctgctt
gttatcttccacgacccgcccgagctgatgggcatcccgcacccggtgaccaacgtgctt
gaagcccacaacacctggctgcaagtccaaaaagaggagtggctaacagagggaacaaac
aaggctgataatgtcaaggattacatctcctgggcggtcgagcataacgtgggcgttatc
gacgtcaacatcccgaagcacatctcagaagccgaccaaaactcacggagctacgagcgg
gagagcccgaaccgggccctcttctccgagcagcttgccgagtacctgtgggagaactac
atcgagtgcgtctatcccactgatctgtcattacttgcagcagtagtaggctgtttgtta
ctaacgaccagaaggaccaacgacaccagccgcatcttcttcatgggggtgggcgatgcc
tttctcggactggccaaccttctcatcaacaaggagcgagtccacacaatggtcagtggc
gtgatatgctttgtggccgagaaccccgtccgcgccgtcgccagcaccaccatcacctgg
ctctccaagtggtacaaagagtacagaagaagtaacaagatgaagaactccctggtcttt
gtgtcccaccggcacatggtgtgggagggccaggagaacaagcagaagcaatacaagcgc
tacgggcggctggtgaagtcgacggcggcgcacacgctgaacgagatgctggtcaaccac
cgcgcggatgtgttcaagtggattgaggagcgagtcgaggccgggtcagagagcagttca
tag

DBGET integrated database retrieval system