KEGG   Trichophyton verrucosum: TRV_07489Help
Entry
TRV_07489         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRV_07489
Protein phosphatases and associated proteins [BR:tve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TRV_07489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 500 aa AA seqDB search
MFYNDPNVLYISIHVYRDGSFYPGGDEGNWDYCGEGLGLGKNVNIPWPTQGMGDGDYLYA
FQEVVMPIGYEFDPDLVIISAGFDAAAGDELGGCFVTPPCYSHMTRMLMNLANGKVAVCL
EGGYNFRSISKSALAVTRTLMGEPPDRLIAPSASRPAVETARRRTLPATVYMVCMVITGE
EGGMLIGVGVGTDIIRQYQAKQLYEEHKLTSLYIYRDTISKSFENQVLASQNYDKVDTLL
VIFHDPPELMGIPHPVTNVLEAHNTWLQVQKEEWLTEGTNKADNVKDYISWAVEHNVGVI
DVNIPKHISEADQNSRSYERESPNRALFSEQLAEYLWENYIECVYPTDLSLLAAVVGCLL
LTTRRTNDTSRIFFMGVGDAFLGLANLLINKERVHTMVSGVICFVAENPVRAVASTTITW
LSKWYKEYRRSNKMKNSLVFVSHRHMVWEGQENKQKQYKRYGRLVKSTAAHTLNEMLVNH
RADVFKWIEERVEAGSESSS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttctacaatgacccgaacgtactatacatctcgatccatgtctaccgggatggcagc
ttctatcccggcggtgacgaaggcaactgggactactgcggtgaaggtctcggtctaggg
aagaacgtcaacattccctggccgacacaaggcatgggagacggcgactacctctatgcc
ttccaggaagttgttatgccaatcggctacgagtttgatcctgacctcgtcatcatatcc
gccggcttcgatgcggcggcgggcgacgagctgggaggctgtttcgtgacacccccttgc
tactcacacatgacgcgcatgctgatgaaccttgccaacggaaaggtagcggtgtgtctt
gagggagggtataacttccgctcgatctccaagtcagcgctagcggttacgcggacattg
atgggcgagccgcccgatcggctgattgcgccgtcagcgtcgcggccggccgttgagacg
gcccgtcgtcgaactttgccggcaaccgtgtacatggtatgtatggtgataacaggagaa
gagggaggaatgctaattggtgttggggtgggaacagatatcatccggcagtaccaggcg
aagcagctgtatgaggagcacaagctgacgagcctgtacatctaccgggacacgatctcg
aagtcgtttgagaaccaggtgctggcgagccagaactacgacaaggtggacactctgctt
gttatcttccacgacccgcccgagctgatgggcatcccgcacccggtgaccaacgtgctt
gaagcccacaacacctggctgcaagtccaaaaagaggagtggctaacagagggaacaaac
aaggctgataatgtcaaggattacatctcctgggcggtcgagcataacgtgggcgttatc
gacgtcaacatcccgaagcacatctcagaagccgaccaaaactcacggagctacgagcgg
gagagcccgaaccgggccctcttctccgagcagcttgccgagtacctgtgggagaactac
atcgagtgcgtctatcccactgatctgtcattacttgcagcagtagtaggctgtttgtta
ctaacgaccagaaggaccaacgacaccagccgcatcttcttcatgggggtgggcgatgcc
tttctcggactggccaaccttctcatcaacaaggagcgagtccacacaatggtcagtggc
gtgatatgctttgtggccgagaaccccgtccgcgccgtcgccagcaccaccatcacctgg
ctctccaagtggtacaaagagtacagaagaagtaacaagatgaagaactccctggtcttt
gtgtcccaccggcacatggtgtgggagggccaggagaacaagcagaagcaatacaagcgc
tacgggcggctggtgaagtcgacggcggcgcacacgctgaacgagatgctggtcaaccac
cgcgcggatgtgttcaagtggattgaggagcgagtcgaggccgggtcagagagcagttca
tag

DBGET integrated database retrieval system