KEGG   Trichophyton verrucosum: TRV_07728Help
Entry
TRV_07728         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tve  Trichophyton verrucosum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRV_07728
Translation factors [BR:tve03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TRV_07728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 763 aa AA seqDB search
MSTFDTLTEQDLQQDEVEIDFSGMPAHIPPQKKTLVEDAELTAVAEFEVRLEEGLDTFVV
FDGLPIVSEDNKAKLIKFLLKKIKKDGPSSSNIDPNRQIFLPMNENGMSEGFAFVEYDTP
EEAFAAIKSLHGTPLDKKHTLAVNKLTDIDRYGREGRIDDEYKPPRIEPFQEKEHLRSWL
GDPNARDQFAMYRGDKVGVFWNMKKDPPENVVDRDHWTQLFVQWSPMGTYLASVHPQGIQ
LWGGPQFSKQKQFPHPFVQLVEFSPQENYLTTWSSRPIQIEGAPGVLSYDEDGKNIIIWD
ITTGKPLRSFVSHDLTAPAGADDAAAQKKKVQWPAFKWSADEKYVARMLQHQSISVYELP
RMNLLDKTVVKIEGVMDFEWSPATVQREGVKRYEQLFSFWTPEIGSNPAKVGLMSIPSKE
IVRTRNLFNVSDVKLHWQSQGAYVCVKVDRHSKSKKSMATNLEIFRVKEKGVPVEVVDSL
KDTVINFAWEPKGDRFVLITTGEAIAGSAVAPKTAVSFFCPEKVKGGAIGNFKLIRTIEK
KTSNGIYWSPKGRFVVVATVHSQQNFDLDFWDLDFEGEKPESEKDLSANLQLMKTVNHFG
VTDVDWDPTGRYVVSSASAWTHSLENGYNIHTFSGTTLAEHPTEKFKQLLWRPRPPTFLS
KEEQKQVRKNLREYSREFDEEDKYAVDIANTAIVEMRKRVLSEWTAWLRKEKQMILEERE
DLGLSPNPDDDIVAQPNITAAEGDTVVEEIVEEIIEETEEIIS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgttcgataccttgaccgagcaggacctgcagcaggatgaagtcgagatcgat
ttctcaggcatgcccgcacacatcccaccccaaaaaaagaccctagtggaagacgctgaa
ctaacagctgttgctgaattcgaagtccgactggaagaaggactcgataccttcgtcgtt
tttgacggactcccaatcgtctccgaagataataaggcgaagttgattaagtttttgtta
aagaaaataaagaaggatggcccctcatcgagcaatatcgacccgaaccgccagattttt
ctacccatgaatgagaatggaatgtccgaaggtttcgcttttgttgaatatgacaccccc
gaggaagcctttgctgccataaagagtcttcacggaacccctctggataagaagcacacc
ttggcagtcaacaagctcactgatatagaccgatatggacgtgaaggccggatagacgac
gaatacaaacctcccaggatcgaaccgttccaggaaaaagaacatcttcgatcatggctg
ggcgatcccaatgcccgcgatcagttcgcaatgtaccgcggtgacaaagttggtgtgttt
tggaatatgaagaaggaccctccagagaatgttgtcgaccgagatcactggacccagctt
tttgtacagtggtctcccatgggtacataccttgcttccgtacatccacaaggtatccaa
ctctggggaggtccccaattcagcaaacaaaaacagttccctcatcctttcgtccagctt
gtggagttctctccccaggaaaactaccttaccacatggtctagccgcccgatacaaata
gagggagcacctggtgttttgtcatatgatgaagacggcaagaatataatcatctgggat
attaccaccggaaagcctctccgatccttcgtcagccatgacctaactgcccccgctggc
gccgatgacgctgctgctcaaaagaagaaagtacagtggcctgcgtttaaatggtcagcg
gatgagaaatatgttgctcgtatgcttcagcaccagtccatatctgtctatgagctacct
cgtatgaaccttcttgacaagaccgtagtcaagattgaaggtgttatggatttcgaatgg
tctcctgctactgtacaaagggaaggtgtcaaacgctatgagcagcttttcagcttttgg
actcctgaaattggaagcaaccctgctaaagttggtttgatgagcataccgtcaaaggag
atcgttcgtacacgaaatcttttcaatgtctccgatgtgaagctacactggcaatcccag
ggtgcctacgtttgcgtcaaggttgacaggcactccaagtccaagaaatccatggctacc
aacctggagatcttccgagtgaaagaaaagggcgtgccagtcgaggttgtcgactcacta
aaggataccgtcataaattttgcttgggaacccaagggtgatcgatttgtcctcatcaca
actggcgaggctatcgcaggctctgctgttgctccaaagactgccgtctctttcttttgc
cctgagaaagttaaaggtggcgctatcggtaacttcaaactcatccgcaccattgagaag
aagacgagcaatggaatctactggtctcccaagggccgattcgttgtcgtcgctaccgtg
cattctcagcaaaactttgaccttgatttttgggatttggactttgagggtgagaagcca
gagagtgagaaagacctttcggccaatctacagctcatgaagactgtcaaccactttggt
gtgactgatgtcgactgggacccaactggtagatacgttgtctccagcgcctctgcctgg
acgcactcgcttgaaaacggctataatattcacaccttctccggtacaacattagcagaa
caccccactgagaagttcaagcaactcctctggcgcccgcgacctccaacattcctttca
aaggaagagcaaaaacaagtccgcaagaacctccgcgaatactctcgcgaatttgacgaa
gaagacaagtacgccgtcgatattgccaacaccgccatagtcgagatgagaaagagagtc
ctcagtgaatggaccgcctggctcagaaaggagaagcaaatgattctcgaggaaagagaa
gatctcggtctgtctcccaacccagatgatgacatcgttgctcaacccaatatcactgcc
gctgagggggatacagtggtagaggagattgtcgaggagatcatcgaagaaactgaagag
atcattagctaa

DBGET integrated database retrieval system