KEGG   Trichophyton verrucosum: TRV_07786Help
Entry
TRV_07786         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MEGKLVQAVTEKKPVPEIDFTLHTMEDGTQVSTQERVCKEVQAPAFNTPSNEQFWSSEDP
TKPDLKFLKQHFFREGRLTEEQALWIINTGASILRSEPNLLEMDAPITVCGDVHGQYYDL
MKLFEVGGDPSETRYLFLGDYVDRGYFSIECVLYLWTLKIWYPNSLWLLRGNHECRHLTD
YFTFKLECKHKYSERVYDACTDSFCALPLAAIMNKQFLCIHGGLSPELHTLEDLKTIDRF
REPPTYGLMCDILWADPLEDFGQEKTGEHFIHNNVRGCSYFFSYHAACAFLEKNNLLSII
RAHEAQDAGYRMYRKTRTTGFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSP
HPYWLPNFMDVFTWSLPFVGEKITDMLIAILNTCSKEELEEETPLSASEAPPSPTLPSTD
PESTEFKRRAIKNKILAIGRLSRVFQVLREESERVTELKTATGGRLPAGTLMLGAEGIKQ
AIHNFEDARKVDLQNERLPPTHEEVTKRAEEDRRQALERAAQEAANDTHLTNVARRISM
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaaactggtgcaagcggtcacggagaagaagcctgtccctgagattgacttc
accctccatactatggaagatggcacgcaggtatccacacaggagcgtgtctgcaaggag
gtgcaagccccggctttcaacacaccttcgaacgaacaattttggtccagcgaagatccc
accaagcccgacctgaagttcctcaagcagcacttcttccgtgaaggtcgtctcacggag
gagcaggcactatggatcatcaatactggagcgtcaatcctcaggtcagagccaaacttg
ctcgagatggatgctcccattacagtgtgtggtgatgttcacggacaatactatgatttg
atgaagctgttcgaggtgggaggagacccttcggagacacgatatctcttccttggagac
tacgttgaccgaggctattttagtattgagtgtgttctgtacctatggactctaaaaatt
tggtaccccaacagtctttggttgctacgtggaaatcacgaatgtcgccatctcacagat
tactttaccttcaagctggagtgcaaacacaagtactccgagagagtctacgatgcctgc
acagattcattctgcgccttgcctctggctgcaattatgaacaaacagttcctctgtatc
cacggtggcttgagtcctgagctgcatacattggaggatttgaaaacaattgaccgtttc
cgggagccaccaacctatgggctgatgtgcgatattctttgggccgaccctctggaagac
tttggtcaagagaaaacgggtgaacacttcatccacaacaatgtccgaggatgttcatat
ttcttctcctatcatgctgcttgcgcattcctagagaagaacaaccttctatccatcatt
cgagcccacgaggctcaagatgccgggtacagaatgtaccgcaagacccgaacgaccgga
ttcccaagtgttatgaccatctttagcgctcccaattaccttgatgtctacaacaacaag
gctgcggtcctcaagtatgaaaacaacgtcatgaacatccgccaatttaactgctcacca
catccttactggctccccaacttcatggacgtctttacctggtcactaccgttcgttgga
gagaaaattacggatatgctcattgccattctcaacacttgctctaaggaagaactcgag
gaagagactcccctgtcagcatccgaagctccaccctcgccaactcttccatcaaccgac
cccgaaagtaccgagttcaaacgacgtgccatcaaaaacaaaatccttgctatcggtcgt
ctatcccgtgtattccaggttctccgagaagagtccgagcgggttactgagcttaaaact
gctactggcggacgtttgccagcaggaacgctcatgcttggcgccgaaggtatcaaacaa
gctatccacaactttgaggacgctcgaaaggtcgatttgcagaacgaacgactaccgccg
acccatgaagaagtcactaagcgtgccgaagaggatcgacgacaagcgctggaacgtgct
gcccaagaggcggctaacgacacgcatctgacaaacgtagcccgaagaatcagcatgtaa

DBGET integrated database retrieval system