KEGG   Trichophyton verrucosum: TRV_07786Help
Entry
TRV_07786         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TRV_07786
Protein phosphatases and associated proteins [BR:tve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     TRV_07786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MEGKLVQAVTEKKPVPEIDFTLHTMEDGTQVSTQERVCKEVQAPAFNTPSNEQFWSSEDP
TKPDLKFLKQHFFREGRLTEEQALWIINTGASILRSEPNLLEMDAPITVCGDVHGQYYDL
MKLFEVGGDPSETRYLFLGDYVDRGYFSIECVLYLWTLKIWYPNSLWLLRGNHECRHLTD
YFTFKLECKHKYSERVYDACTDSFCALPLAAIMNKQFLCIHGGLSPELHTLEDLKTIDRF
REPPTYGLMCDILWADPLEDFGQEKTGEHFIHNNVRGCSYFFSYHAACAFLEKNNLLSII
RAHEAQDAGYRMYRKTRTTGFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSP
HPYWLPNFMDVFTWSLPFVGEKITDMLIAILNTCSKEELEEETPLSASEAPPSPTLPSTD
PESTEFKRRAIKNKILAIGRLSRVFQVLREESERVTELKTATGGRLPAGTLMLGAEGIKQ
AIHNFEDARKVDLQNERLPPTHEEVTKRAEEDRRQALERAAQEAANDTHLTNVARRISM
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaaactggtgcaagcggtcacggagaagaagcctgtccctgagattgacttc
accctccatactatggaagatggcacgcaggtatccacacaggagcgtgtctgcaaggag
gtgcaagccccggctttcaacacaccttcgaacgaacaattttggtccagcgaagatccc
accaagcccgacctgaagttcctcaagcagcacttcttccgtgaaggtcgtctcacggag
gagcaggcactatggatcatcaatactggagcgtcaatcctcaggtcagagccaaacttg
ctcgagatggatgctcccattacagtgtgtggtgatgttcacggacaatactatgatttg
atgaagctgttcgaggtgggaggagacccttcggagacacgatatctcttccttggagac
tacgttgaccgaggctattttagtattgagtgtgttctgtacctatggactctaaaaatt
tggtaccccaacagtctttggttgctacgtggaaatcacgaatgtcgccatctcacagat
tactttaccttcaagctggagtgcaaacacaagtactccgagagagtctacgatgcctgc
acagattcattctgcgccttgcctctggctgcaattatgaacaaacagttcctctgtatc
cacggtggcttgagtcctgagctgcatacattggaggatttgaaaacaattgaccgtttc
cgggagccaccaacctatgggctgatgtgcgatattctttgggccgaccctctggaagac
tttggtcaagagaaaacgggtgaacacttcatccacaacaatgtccgaggatgttcatat
ttcttctcctatcatgctgcttgcgcattcctagagaagaacaaccttctatccatcatt
cgagcccacgaggctcaagatgccgggtacagaatgtaccgcaagacccgaacgaccgga
ttcccaagtgttatgaccatctttagcgctcccaattaccttgatgtctacaacaacaag
gctgcggtcctcaagtatgaaaacaacgtcatgaacatccgccaatttaactgctcacca
catccttactggctccccaacttcatggacgtctttacctggtcactaccgttcgttgga
gagaaaattacggatatgctcattgccattctcaacacttgctctaaggaagaactcgag
gaagagactcccctgtcagcatccgaagctccaccctcgccaactcttccatcaaccgac
cccgaaagtaccgagttcaaacgacgtgccatcaaaaacaaaatccttgctatcggtcgt
ctatcccgtgtattccaggttctccgagaagagtccgagcgggttactgagcttaaaact
gctactggcggacgtttgccagcaggaacgctcatgcttggcgccgaaggtatcaaacaa
gctatccacaactttgaggacgctcgaaaggtcgatttgcagaacgaacgactaccgccg
acccatgaagaagtcactaagcgtgccgaagaggatcgacgacaagcgctggaacgtgct
gcccaagaggcggctaacgacacgcatctgacaaacgtagcccgaagaatcagcatgtaa

DBGET integrated database retrieval system