KEGG   Trichophyton verrucosum: TRV_07844Help
Entry
TRV_07844         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TRV_07844
Protein kinases [BR:tve01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   TRV_07844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 684 aa AA seqDB search
MGRGPVPKFQSIKCISELQPRINKQPAFRRANPEGGFISPLQALTTHLPATYRICNPTFK
YESSRNPRRVLTKPSKGVKNDGYDNDDSDYILYVNDILGSEEANHKYDTLDTLHTSNPQQ
HTDSLSTRNRYLILDVLGQGTFGQVVKCQNLKTQEVIAVKVIKNRTAYFNQSMMEVSVLD
LISSKLDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQ
QLLNGLALLNKARLIHCDLKPENILLKKFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLG
LPLFPGSSEYNQIARITEMLGLPPVWMLENGKQAGEFFEKTQDEFGRQSFRLKSMEQYSR
EHNTKEQPSKKYFQATTLPEIIRSYAMPRKNMKQAEIDREMNNRVAFIDFVRGLLSINPL
ERWSPQQAKLHPFITQQKFTQPFVPPVHLKSSVINKSVAPGVQQQQQAEAASKQRAQAAQ
AQAAQAQANSAAAAAAQSAYALQMNQFNAPHNQPPPVYNNMYNSQQQQQHPAPPPQQQPQ
QQQGPPPPYPTQQGYQMPIMQSGHMSMPPQQTQYGSSQNLYAQATTRAGRQRATTMDQQQ
SGIPPSIQRVASHLDPNSPIRLQPSPAYYPPPADGYPDASGPGQRRTSRARNNGSHGRNR
DFIRSLEDGALGDGFMNQNQNQWH
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggggtcccgtaccaaagttccagagtatcaaatgcatcagcgagttacaaccc
aggatcaacaagcagccagctttccgacgagccaacccagaaggagggttcatcagtcct
ttacaagccctcacaacacatctaccagcaacgtatcgaatttgcaacccgaccttcaag
tacgagtcatctaggaaccctcgacgtgtgctgacgaagccgagcaaaggtgtcaagaac
gatggctacgataacgatgatagcgactatattctttatgtcaacgatattctcggcagt
gaggaagcaaaccacaagtacgacactcttgacactttgcacacgtcgaatccacagcag
catactgactccttgtcaactaggaaccgctaccttatccttgacgtcctcggccaagga
acttttggacaagtagtcaagtgtcaaaatctaaagacgcaggaagtcattgccgtgaaa
gtcatcaagaataggaccgcatacttcaaccagagtatgatggaagtgtcggtcttggat
ttgattagcagcaaacttgacaagaacgatgaccaccatctacttcgactaaaggacacc
ttcatccatcgccaacatctgtgcttggtatttgagttgctcagtgttaatctttacgag
ttgatcaagcaaaatcagttccgtggcttgagtaccacactcgtgagggtgttcgctcaa
cagttgcttaacgggctcgcactcttgaacaaagctagattgatacattgcgatctaaag
ccggagaacatcttgctaaaaaaattttaccgctcacccgaagttctcctaggattgcca
tactcctcggcaattgatatgtggtccctcggatgcattgttgttgaactcttcctcggg
cttcctctcttccctggatcatcggagtacaaccaaatagctagaataacagaaatgctg
ggcttgcctccagtatggatgctcgagaacgggaagcaggctggtgaattctttgagaag
acacaagatgagtttggccgacagagtttcagactgaagagcatggaacaatattctcgc
gagcacaacaccaaagaacagccaagcaagaagtacttccaagctaccacactgccggaa
atcatcaggtcatacgcaatgccgcggaagaacatgaagcaggccgaaattgacagagaa
atgaacaaccgcgtggcattcattgattttgttcgcggcctcctatccattaaccctctt
gaaagatggtctccgcaacaagccaaactccaccccttcatcacgcagcaaaagttcacc
caaccgttcgtcccgccggtccatctcaaatcctccgtcatcaataaatctgttgctccc
ggagtccaacaacagcaacaagcagaagcagcatccaagcaacgcgcccaagctgcacaa
gcacaagcggcccaagcccaagcaaactctgccgctgccgctgccgcacaatctgcttat
gctcttcaaatgaaccaatttaacgcaccgcacaatcaacctccaccggtctacaacaac
atgtataattcccagcagcagcaacaacacccggctccgcctccacagcaacagcctcag
cagcaacagggcccaccaccaccctatcctacacaacagggttatcaaatgcctatcatg
caatctggccatatgtctatgccaccgcagcagacacaatatggctcctctcaaaaccta
tacgcgcaagcaactacgcgcgcaggtcgacaacgggctacgacaatggatcaacaacag
agtggtattccaccgtctatacaacgggtggctagtcacttggaccccaactcacccatt
cgactccagcctagcccggcgtactacccacctccagccgacgggtaccctgacgcttcc
ggcccaggtcaaagacgaactagccgggcaagaaacaacggttcacacggccgaaataga
gacttcatccgcagtctcgaagatggtgcactgggagatggcttcatgaaccagaaccag
aaccaatggcactga

DBGET integrated database retrieval system