KEGG   Trichophyton verrucosum: TRV_07876Help
Entry
TRV_07876         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tve  Trichophyton verrucosum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TRV_07876
   00052 Galactose metabolism
    TRV_07876
   00500 Starch and sucrose metabolism
    TRV_07876
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_07876
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TRV_07876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MRNALNALSDTVKDPAEKKRFEAEMDNFFSLFRRYLNDKAKGNVLSWDRIAPPQPNQVVE
YDDLGESASVEYLKKLAVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEYLNRT
YNVSVPLVLMNSFNTDDDTQSIIKKYEGHNIDIITFNQSRYPRILRDSLLPAPKSYNSAI
SDWYPPGHGDVFESLMNSGTLDKLLDRGVEIIFLSNADNLGAVVDMRILEHMVKNDAEYI
MELTNKTKADVKGGTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNLRAV
KRVVEEGGLQMEIIPNGKTIPADKKGEADISIIQLETAVGAAIRHFKNAHGVNVPRRRFL
PVKTCSDLMLVKSDLYTLKHGQLVIDPNRFGDAPLIKLGTDFKKVSDFMNHIPSIPRILE
LDHLTISGAVNLGRGVTLKGTVIIVATEGSTIDIPPGSILENVVVQGSLRILEH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgccctcaacgcccttagcgacaccgtcaaggatcccgccgaaaagaagcga
ttcgaggccgagatggacaacttcttctcgctcttccgcagatacctgaatgacaaggcc
aagggcaacgtcctctcctgggaccgcattgctcctccacagcccaaccaggtggtcgag
tacgacgacctgggcgagtccgcctcggtcgagtatctcaagaagctcgctgtcgtcaag
ctcaatggcggcctgggtacctccatgggatgcgtgggaccaaagtccgtcatcgaggtc
cgcgagggcatgtccttcctcgacctctccgtcagacagatcgagtacctcaaccgcacc
tacaacgtcagcgtgcccctggtgctcatgaactccttcaacaccgacgatgacacccag
tccatcatcaaaaagtacgagggccacaacatcgacatcatcaccttcaaccagtccaga
tacccccgtatcctcagggactcccttctcccagcccccaagagctacaactccgccatc
agtgactggtaccccccaggtcacggagacgtcttcgagtccctcatgaactcgggcacc
ctcgacaagctgctcgaccgcggtgtcgagatcatcttcctttccaacgctgacaacttg
ggtgctgtcgtcgacatgcgcatcctcgagcacatggtcaagaacgacgccgagtacatc
atggaactcaccaacaagaccaaggccgacgtcaagggtggtaccatcatcgactacgag
ggtaaagcccgcctgcttgaaatcgcccaggtgcccaaggagcacgtcaacgagttcaag
tccatcaagaagttcaagtacttcaacaccaacaacatctggatgaacctccgcgccgtc
aagcgtgtcgtcgaagagggcggcctccagatggagatcatccccaatggcaagaccatc
cctgccgacaagaagggcgaggcagacatctccatcatccagctcgagactgccgtcggt
gctgccatccgccacttcaagaacgctcacggagtcaacgtgccccgtcgccgcttcttg
cccgtcaagacctgttcggatctcatgctcgtcaagtctgacctctacaccctcaagcac
ggccagctcgtcatcgaccccaaccgcttcggtgacgctcccctgatcaagctcggaaca
gacttcaagaaggtctccgacttcatgaaccacatccccagcatccctcgtatcctcgag
ctcgaccacctcaccatctccggtgctgtcaacctcggccgtggtgtcaccctcaaggga
accgtcatcattgtggccaccgagggcagcaccattgacatccccccaggctccatcctt
gagaacgtcgtcgtccagggcagtcttcgcatcctcgagcattag

DBGET integrated database retrieval system