KEGG   Trichophyton verrucosum: TRV_08070Help
Entry
TRV_08070         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tve  Trichophyton verrucosum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tve03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1719 aa AA seqDB search
MEGDESSGNLRGLYQDLSASSRFALPNAERLVAELEATLEDFRRLLDKPAKNNDSRKTVL
SGKIKLDDVEYEVNAEFQQEVLQVADALDVDEIEAARYYIRAQSDAKKLDRSPIVSSIIR
FHEQREFVLECLRLILHESFEVEREETQLLMKEYVASVLEIQNGPLRNGSLFARKCMDAM
TDIEKWLVLLGEQIQKASIVGQSQEADILEVIEYQKQSLGKQHESLGAIVSYLFKGTYTS
SEDFRKLMEKTKKVDKFDMLLVHYVPSIITAASQYGSSEGQGIEDARSLHKVIVESKDSQ
GWVLPQFHAATIVFWLAEYSGWYFDSTAAGPIQGLNSAEESAKLSKSLLAALEDGGFHFI
LSICAGVGLDEWKNAERNELVTLLLKDAARLTLEPDAPSPYFHSLLMESIEGFTESLIAN
MPDAIRMLKSEEDTQRLDQITALRDSVSPNLHRGPVEVRMHLECLLTIIAFSFDGRNDAA
QEFWLDPDGNLYGFLQWVSKRQTVPRASAFCEMLCSISGGEENSAAAHKFLIDEDSLSSA
KFRRSASMNWTQMFAEIQLYAVRITERPSTTQSSTLRLRKLEVPDIEEPESPIMLTSYLR
LISHLSRENSKIREWILQHQTTNLISVLLTLCGASIPQHLRAAIFVTLRCLMIDRTSAHS
NEMWTSLDNCISGSGSLPLALSPLPPLSSPQVRNERHAFQRITESFDQMNAFVEMLNQLV
GPVSDSLDSQLTLPFPESLGSTYRMPGIEPYVDYVMGQAFANRSVMAEDKESHLLQWNCM
NFAATALESFNENLVSIVSQPSISAQPNWKVTFSTYLRLHPFSRVMEWLFNEDVLRVLFS
CSHRDADGVSKASSDSILISSLVRSIDIMNLILDHQPTYFNIVRPIIKSSGQDSSFNIAN
STLASFEDCVIDNLGLISDLCLYCGTGHPQLTLTSLALLEKLSASRKLNKSSNISSRWQS
TNQMVEQLNSNVEADRVARSLASQIDVDIRELESGPESSGYLIKMGLLQLLDKCLKMSPE
KPTIAHLLLGFSCLGNTLDIPPDGLFENGISLLHSILEFVKAYPLGMDGAVISWMIHLRC
LGFQVLLNLWASPLSSNLTLPHLRAGQLLPVLFMSQPVVTAETLWDDFRTNEPDFWLSSS
PSSLSELLMLRTLLYEYATTEVRAVYKQGSPSVQRDTLRTIMGTTSVEGDQSVEHPSLFD
LFDFADIDVGFSYTWPELQFFGSVNVESCVKTEENGVVVLYDIEALQELLQLVKEDLVAD
GVVTSQNEEQIMAEKEKLLLFLSATNEFRYVQFNRFVALKAWTDLVTIITATCKMDPTYM
ASFIQQTLQLILPKFESSIVETPAEAIELAHLGETLIDKLDEIPTDTNGDVIDERLDYLF
QVCTSGIPQTSDNITLRESLYQISSKHLARITASSSTDDRFKEHAHSTVKAAGPTLMETI
CDDAYGSSESCRVSALVLLNLLGILDQQRNSSLLVNLITHSNYLGMFLDVLRVMPSEFRN
AKATGTLLIFCSINRAVSLTACYLDTAQLLLFYESQLSLLQQLSQTKAGASQLLDAGLFQ
AVKESQLFSADPDIGIGEANFNSWIRVPVTVFINQEFLLDIDNSDALQRYYELLLSVLQV
IVSTIFSRGLHNQAICDQTRAFLSENRQSMVGIFKRCAKSGSSDDPSMKKCLDNLAKSYT
ALIASVDFLDVSAFPLLHLFPIYTHHPHAPEASFLHTSE
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgatgagagttctggcaacttacggggcctatatcaggacctgtcagcctcg
tccaggtttgctcttcccaatgcagagaggcttgtggccgagttggaagcaacacttgag
gacttccgcaggctgttagacaagccagccaaaaacaacgacagcagaaagactgttctt
tcaggcaaaattaagcttgacgatgtcgaatatgaggtcaacgcggagttccagcaagaa
gtattgcaggtggcagatgctttggacgtcgatgaaattgaggctgcgcgctattatatt
cgtgcacaatccgatgctaagaagctagatcgatcgccaatcgtcagctctataatccgt
tttcacgaacaaagagagttcgttctagagtgcctgaggctcatccttcacgagtctttt
gaggtagaacgggaagaaactcagctcttaatgaaggaatatgttgcatcggtacttgaa
atacagaacggccctttacggaatggctcgctatttgctaggaaatgcatggacgcgatg
acagacatcgaaaagtggttggttcttttgggggaacagatacaaaaggcatcaattgtt
gggcagtctcaggaagctgatattcttgaagttattgaatatcaaaagcaaagtcttggg
aaacagcatgaatctttaggagccatcgtgtcctacctcttcaaaggcacctacacaagc
tctgaagacttccgcaaactcatggagaaaacgaaaaaggtcgacaaatttgacatgcta
ctcgtccattatgtcccctcaatcataactgcggcctcccaatatggctcatcggaaggt
caggggattgaagacgcaagatccttacacaaagtgattgttgagtcaaaggactcccaa
ggctgggtactcccccagtttcacgctgccaccatagtcttttggctagcggagtatagt
ggctggtactttgatagcacggcggctggaccgattcaaggtttaaattctgccgaagag
tccgccaagctatcaaaatcacttctcgctgccctcgaggacggcggttttcactttatt
ctaagcatttgcgctggagttggtttggatgaatggaaaaatgcagaaaggaacgagctg
gttacacttctactaaaggatgcggcccgtctgactctcgaacccgacgctccctcgcca
tatttccattccttactcatggagagtattgaaggattcaccgagtctctgattgcaaac
atgcccgatgctatccgaatgctgaagtcggaagaagatacccagcgattggatcagatt
actgcgctcagggactcagtttctccaaatctccaccggggtcccgtagaggttcgcatg
catttagaatgtttactaactataatcgcgttctccttcgacggcaggaatgatgctgct
caagagttttggttggaccctgacggtaatttatacggattccttcaatgggtatcaaaa
cgtcaaaccgttccccgggccagtgcattttgcgagatgttatgctctatttcaggtggg
gaagagaattcggccgcggcacataaattcctcattgacgaggattctctatcttctgca
aagtttcgaaggtcggcttctatgaactggactcaaatgttcgccgaaattcaactctat
gctgtgagaattactgagcgcccctcaacgacccagtcttctacactacgcctccgtaaa
ttggaagtcccagatattgaggagcccgagagcccaattatgcttaccagctacctacgt
ctcatcagccatctgtcccgggagaatagtaaaattcgtgaatggattctgcaacatcaa
accaccaacttgatctcggtacttctcactctttgtggtgcgtcaatccctcagcatctt
cgggcagctatctttgttactctgcgatgtttaatgatagaccggacgtcagcccattca
aacgaaatgtggacttctctggacaactgtatctctggctcaggctctcttccactggca
ctttctccgctaccccccttgtctagcccacaagtacggaacgagcggcatgctttccaa
cgcatcacagagagctttgatcagatgaatgcgtttgttgaaatgcttaaccagctggtt
ggtcctgtatccgattcattggattcacaattgaccctgccattccctgagtcgttgggc
tccacgtaccgaatgcctggtattgagccttatgtcgattatgtaatgggccaggctttc
gcaaacagaagtgtcatggctgaagacaaggagtcacatctcttgcagtggaattgcatg
aattttgctgctactgctctagagtccttcaacgagaatcttgttagcattgtcagtcag
ccgtcaatatccgcacagccaaactggaaagtgacattctcaacataccttcgattacat
ccattttcacgtgttatggaatggcttttcaacgaagatgtgctcagagtcttattttct
tgctctcacagagatgcagatggggtgtccaaggcttcttcagactccatactgatttcc
agcttggtccggagtattgatatcatgaatctaattctcgaccaccagcccacatacttc
aatattgttcgaccaataatcaaaagctccgggcaagactcttctttcaacatcgccaat
tctacccttgcatcttttgaagactgtgttattgataacttagggttgatttctgaccta
tgtctttattgcgggacggggcatcctcaactgacgctaacttcactggctcttttggaa
aagctgtcagcttccagaaagttaaacaaatcttcaaatatctcatctcgatggcaatct
acaaaccagatggttgaacagttgaactccaatgttgaagcagaccgagtagcccgatca
ctagcctcccaaatagatgtagatattcgggaactagagagtggtccagaatcatccggc
taccttattaagatgggactacttcagctactggataagtgcctcaagatgtctcctgag
aagccaacaattgctcatctccttcttggtttctcctgccttggtaataccctcgacatc
ccaccagatggcttgtttgaaaatgggatttcccttttacactctatactcgagtttgtt
aaggcttatcctcttggaatggatggggcagttatatcctggatgatacatctaagatgt
ttgggtttccaagttttactgaacctgtgggcctcacctctttcatctaatcttacttta
ccgcatctccgcgcaggtcaacttttaccagtgctcttcatgtctcaaccagttgttacc
gcagagacgttatgggacgacttccgaacaaacgagcctgatttctggctgtcatcgtca
cccagctcgctatctgagctgctcatgcttcgcacactactttatgaatatgcaacgaca
gaggtgcgggctgtgtataagcaaggctctccatctgtccagagggatactttacggaca
attatgggaacaacatcagtcgagggtgaccagagcgtcgaacatccctctttgtttgat
cttttcgattttgctgatattgatgtcggcttttcttatacatggcctgaattgcagttc
tttggtagcgtcaacgttgaaagttgcgtgaagacggaggaaaacggagtggttgtgctt
tatgacattgaagcactacaagaactccttcagcttgtgaaagaggatctcgttgccgat
ggtgtagtgacatcacaaaacgaggagcaaatcatggctgagaaggagaaacttttacta
tttttaagtgctactaacgaattccgttatgttcaattcaatcggtttgttgccttaaag
gcgtggacagatctagtgaccatcattactgccacttgcaaaatggaccctacatacatg
gcttccttcattcagcaaacactgcaactgatactaccaaagtttgagtcatcaatagtc
gaaaccccagcggaagctattgaactggcccacctcggtgagactctcattgacaagctt
gatgagatacccaccgatacaaacggggatgtgatcgatgagagattggactacttgttc
caagtctgcacaagcggcatcccgcaaacttccgacaacatcacactccgagaatctcta
tatcaaatatcctcgaaacatctcgcccggattacagcatctagttcaacagatgaccga
ttcaaggagcacgcgcacagcaccgtcaaggctgcagggcctacactcatggaaactatc
tgcgatgatgcgtacggcagcagcgagagttgcagagtctctgccctggtgttgctaaac
ctcttagggatccttgaccagcagagaaattcttcccttctggtcaacttgattacccac
tccaactatcttggaatgttcctagacgtattgagggtaatgccttcggagttccgaaat
gccaaagctacaggtacgcttctgattttctgctccataaacagggctgtttcacttaca
gcctgctatctagataccgcacagctgttgctgttctacgagtcccaactatcacttctc
caacaactttcacagacgaaggctggcgcatcgcagctcctagatgctggtttattccag
gctgtgaaggaatcacagctattttctgctgatccagatataggcataggtgaggcaaat
ttcaactcttggatccgagtaccagtcaccgtctttattaaccaggagttcctattagat
atcgacaacagtgacgcacttcagcgatactatgaactacttttgtcagttctccaagtg
attgtgtccactatcttctctagagggttgcataatcaggccatctgtgaccagacgaga
gcattcctctccgagaacagacaaagcatggttggcatattcaagcgatgcgcaaagagt
ggaagctcagatgaccctagcatgaaaaaatgcctggacaatctggccaaatcgtacact
gcattgattgcctctgtcgacttcctggacgtaagtgcattccctctcctccatctcttc
cccatctacacacaccatcctcatgcaccagaggcatcgttcttacatacttctgaatag

DBGET integrated database retrieval system