KEGG   Thiocystis violascens: Thivi_0228Help
Entry
Thivi_0228        CDS       T02138                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tvi  Thiocystis violascens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thivi_0228
Enzymes [BR:tvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Thivi_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233714..235225
Genome map
AA seq 503 aa AA seqDB search
MHRTSGILLHPTSLPGPYGIGDLGPTAHRFIDFLAGAGQGLWQMLPLGPTGYQDSPYQCT
SAYAGNPLLISPDLLLQAGWIQESDLDPPEFTRDQVDFGAVHVWKHNLIQRAMNGFKADA
TAADRDDFAYFCETHRIWLEDFALYHALKVHHELRPWTDWAPEFALRDPGALADWSKANP
GELELQRFIQYVFFRQWGELRAYARARGVHLIGDMPIFVAHDSSEVWTHPEWFELDDHGH
PTVIAGVPPDYFSSTGQRWGNPLYRWETLAADGYSFWVERLRRVLELVDLVRIDHFRGFA
AYWEIPAAEETAISGRWVPGPGMALFDALREALGDDLPLIAEDLGVITEDVEALRDDLKL
PGMAVLQFGFEDTEGGFGRSAFLPHNHRRRLAVYTGTHDNNSLLGWWADKDDAIRHNARV
YLNSNGEELNWDFIRAALSSVAALALFPMQDVLGLGAEACMNRPGTANGNWTWRYREEMV
SEANAARLRELTRLYGRLPYSAT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcaccagcggcattttgcttcatccgacctcgctgcccggtccctacgggatt
ggcgatctcgggccgaccgcgcaccgtttcatcgattttctcgcaggagcggggcaaggt
ctttggcagatgctgccattggggccgaccggctatcaggattcgccctatcagtgcacc
tcggcctacgcggggaatccgctcctcatcagtccggacctgctgctgcaggcgggctgg
atccaggagagcgatctcgatccgcctgaattcacgcgggatcaagtggactttggcgcc
gttcatgtctggaaacataacctgattcagcgggcgatgaatggtttcaaggcggacgcg
accgcggcggatcgtgacgatttcgcctatttttgcgagacccatcggatctggctcgaa
gattttgcgctctatcatgccttgaaggtccaccacgagcttcgcccctggaccgactgg
gcgcccgagttcgccctgcgcgatcccggggcgttagccgattggtccaaggccaaccct
ggcgaactcgaactccagcgctttattcagtacgtcttctttcgccagtggggcgaacta
cgggcctatgccagggcgcggggtgtccatctgatcggcgacatgccgatctttgtcgcc
cacgattcgagcgaggtctggacccatccggaatggttcgaactggatgatcacggccac
ccgacggtgatcgcgggcgttccgccggattatttcagcagtaccgggcagcgctggggc
aatccgctctaccgttgggagacgctggcggccgacggctacagtttctgggtcgagcgg
ttgcgccgggtgctcgaactggtcgatctggtgcggatcgatcactttcgcggcttcgcg
gcctactgggagattcccgccgcggaggaaaccgcgatcagcggccgttgggtgccgggt
ccgggaatggcgctgttcgatgcgctccgcgaggcgctcggcgacgacctgccgctgatt
gccgaggatcttggagtcatcaccgaggatgtcgaagcactgcgggacgacttgaaactg
cccggcatggcggttctgcaattcggtttcgaggataccgagggcggcttcggacgctcc
gcctttctgccgcacaatcatcgccggcggctggccgtctacaccggtacccacgacaac
aacagcctgcttggctggtgggcggacaaggatgacgcgattcggcacaatgcccgcgtc
tatctcaatagcaacggcgaggaactgaattgggacttcatccgcgccgcgctctcttcc
gtggcggcgctggccctgttccccatgcaggatgtcctcggacttggcgccgaggcgtgc
atgaatcgtcccggcacggccaacgggaactggacgtggcggtatcgcgaggagatggtc
agcgaggccaacgccgcgcgtctgcgcgaactgacccgactctatgggcggctaccctat
tcggcgacctga

DBGET integrated database retrieval system