KEGG   Thiocystis violascens: Thivi_0249Help
Entry
Thivi_0249        CDS       T02138                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tvi  Thiocystis violascens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thivi_0249
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thivi_0249
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thivi_0249
Enzymes [BR:tvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thivi_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261806..263209
Genome map
AA seq 467 aa AA seqDB search
MHYLSTRGGIAPVGFTDAVMMGLATDGGLLVPADIPQIDTGTLRAWSGLRFQELALEVMT
PFVGEEIPRADLRALIDASYATFSHPEVTPVVEADGVRILELFHGPTAAFKDVALQFLGN
LFESLLARDGGSLNIVGATSGDTGSAAIYGVRGKQRIQIFILHPKGRVSPIQERQMTTVL
DANVHNLAVRGTFDDAQNIVKALFNDLPFKSAYRLGAVNSINWARILAQTVYYFYAWGRI
SGGDPARRVSFAVPTGNFGDVFAGYLAKRMGLPIDRLIIATNRNDILTRFVHTGAYAVGD
EVYQTLSPAMDIQIASNFERYLYFLHDGDTARIRALLADLQATGRLEIEPERQARVRSDF
DAVAVSDPETLEQIRATHAASGYILCPHTAVGVRAAGDRDGVVCLATAHPAKFNEAVTAA
IGREAAAPPSLRGLMEKEVRCAELEATVGAVKSHLEVTLGALAGGDA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcattatctgagcacacggggcggaatcgcccccgtcggtttcacggacgcggtcatg
atggggctcgccaccgatggcgggctactggtgcccgccgacattccccaaatcgatacc
ggtaccttgcgtgcgtggtcggggctgcgcttccaggaactggcactggaggtgatgacg
ccctttgtcggcgaggagatcccgcgcgcggatctgcgcgcgctgatcgacgcctcctac
gcgaccttctcgcaccccgaggtgacgccggtggtggaggccgacggcgtccggatcctc
gaacttttccacggaccgaccgccgccttcaaggacgtggcgttgcaatttctcggaaat
ctgttcgagtctctgctggctcgcgacggcggttcgctcaatatcgtcggcgcgacctcc
ggcgataccggttcggcagccatttatggcgtgcgcggcaagcagcgcatccagatcttc
atcctgcaccccaagggccgggtctcgccgatccaggaacggcagatgaccacggtgctg
gatgccaatgtgcacaatctcgccgtgcgcggaaccttcgacgacgcccagaatatcgtc
aaggcgctgttcaacgatctgcccttcaagtccgcctatcgtctcggggcggtcaactcg
atcaattgggcgcggatcctggcccagacggtttactacttttatgcctggggccggatc
agcggcggcgatcccgcgcggcgtgtcagtttcgcggtgcccaccggcaacttcggcgat
gttttcgctggttatctcgccaagcggatggggctaccgatcgatcgtctgatcatcgcc
accaaccggaacgacatcctgacgcgcttcgtgcacactggcgcctatgccgtcggggat
gaggtataccaaactctgagtccggcgatggatattcagatcgcatccaacttcgagcgc
tatctctatttcctgcacgatggcgacacggctcggatacgcgccttgctggccgatctg
caagcgaccgggcggctggagatcgagcccgagcggcaggcgcgggtccgctcggacttc
gacgccgtggcggtgagcgatcccgagaccctggagcagatccgcgccacgcacgcggcc
agcggttatatcctctgtccgcatacggccgtgggggtgcgggcggcgggcgaccgggac
ggtgtcgtctgtctcgcgacggcccatcccgccaagttcaacgaggcggtgactgcggcg
atcgggcgggaggcggcggcgccgccgtcgctgcgggggttgatggagaaggaggtgcgt
tgcgccgaactggaggcgacggtcggggccgtcaagagccatctcgaagtgacgcttggc
gctttggcgggcggggatgcctga

DBGET integrated database retrieval system