KEGG   Thiocystis violascens: Thivi_0249Help
Entry
Thivi_0249        CDS       T02138                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tvi  Thiocystis violascens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tvi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tvi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tvi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261806..263209
Genome map
AA seq 467 aa AA seqDB search
MHYLSTRGGIAPVGFTDAVMMGLATDGGLLVPADIPQIDTGTLRAWSGLRFQELALEVMT
PFVGEEIPRADLRALIDASYATFSHPEVTPVVEADGVRILELFHGPTAAFKDVALQFLGN
LFESLLARDGGSLNIVGATSGDTGSAAIYGVRGKQRIQIFILHPKGRVSPIQERQMTTVL
DANVHNLAVRGTFDDAQNIVKALFNDLPFKSAYRLGAVNSINWARILAQTVYYFYAWGRI
SGGDPARRVSFAVPTGNFGDVFAGYLAKRMGLPIDRLIIATNRNDILTRFVHTGAYAVGD
EVYQTLSPAMDIQIASNFERYLYFLHDGDTARIRALLADLQATGRLEIEPERQARVRSDF
DAVAVSDPETLEQIRATHAASGYILCPHTAVGVRAAGDRDGVVCLATAHPAKFNEAVTAA
IGREAAAPPSLRGLMEKEVRCAELEATVGAVKSHLEVTLGALAGGDA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcattatctgagcacacggggcggaatcgcccccgtcggtttcacggacgcggtcatg
atggggctcgccaccgatggcgggctactggtgcccgccgacattccccaaatcgatacc
ggtaccttgcgtgcgtggtcggggctgcgcttccaggaactggcactggaggtgatgacg
ccctttgtcggcgaggagatcccgcgcgcggatctgcgcgcgctgatcgacgcctcctac
gcgaccttctcgcaccccgaggtgacgccggtggtggaggccgacggcgtccggatcctc
gaacttttccacggaccgaccgccgccttcaaggacgtggcgttgcaatttctcggaaat
ctgttcgagtctctgctggctcgcgacggcggttcgctcaatatcgtcggcgcgacctcc
ggcgataccggttcggcagccatttatggcgtgcgcggcaagcagcgcatccagatcttc
atcctgcaccccaagggccgggtctcgccgatccaggaacggcagatgaccacggtgctg
gatgccaatgtgcacaatctcgccgtgcgcggaaccttcgacgacgcccagaatatcgtc
aaggcgctgttcaacgatctgcccttcaagtccgcctatcgtctcggggcggtcaactcg
atcaattgggcgcggatcctggcccagacggtttactacttttatgcctggggccggatc
agcggcggcgatcccgcgcggcgtgtcagtttcgcggtgcccaccggcaacttcggcgat
gttttcgctggttatctcgccaagcggatggggctaccgatcgatcgtctgatcatcgcc
accaaccggaacgacatcctgacgcgcttcgtgcacactggcgcctatgccgtcggggat
gaggtataccaaactctgagtccggcgatggatattcagatcgcatccaacttcgagcgc
tatctctatttcctgcacgatggcgacacggctcggatacgcgccttgctggccgatctg
caagcgaccgggcggctggagatcgagcccgagcggcaggcgcgggtccgctcggacttc
gacgccgtggcggtgagcgatcccgagaccctggagcagatccgcgccacgcacgcggcc
agcggttatatcctctgtccgcatacggccgtgggggtgcgggcggcgggcgaccgggac
ggtgtcgtctgtctcgcgacggcccatcccgccaagttcaacgaggcggtgactgcggcg
atcgggcgggaggcggcggcgccgccgtcgctgcgggggttgatggagaaggaggtgcgt
tgcgccgaactggaggcgacggtcggggccgtcaagagccatctcgaagtgacgcttggc
gctttggcgggcggggatgcctga

DBGET integrated database retrieval system